You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07991
Secondary Accession Numbers
  • 13702
Name Secretogranin-2
Synonyms
  1. Chromogranin-C
  2. SN
  3. Secretogranin II
  4. Secretoneurin
  5. SgII
Gene Name SCG2
Protein Type Unknown
Biological Properties
General Function Involved in chemoattractant activity
Specific Function Secretogranin-2 is a neuroendocrine secretory granule protein, which is the precursor for biologically active peptides
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35-q36
SNPs SCG2
Gene Sequence
>1854 bp
ATGGCTGAAGCAAAGACCCACTGGCTTGGAGCAGCCCTGTCTCTTATCCCTTTAATTTTC
CTCATCTCTGGGGCTGAAGCAGCTTCATTTCAGAGAAACCAGCTGCTTCAGAAAGAACCA
GACCTCAGGTTGGAAAATGTCCAAAAGTTTCCCAGTCCTGAAATGATCAGGGCTTTGGAG
TACATAGAAAACCTCCGACAACAAGCTCATAAGGAAGAAAGCAGCCCAGATTATAATCCC
TACCAAGGTGTCTCTGTCCCCCTTCAGCAAAAAGAAAATGGCGATGAAAGCCACTTGCCC
GAGAGGGATTCACTGAGTGAAGAAGACTGGATGAGAATAATACTCGAAGCTTTGAGACAG
GCTGAAAATGAGCCTCAGTCTGCACCAAAAGAAAATAAGCCCTATGCCTTGAATTCAGAA
AAGAACTTTCCAATGGACATGAGTGATGATTATGAGACACAGCAGTGGCCAGAAAGAAAG
CTTAAGCACATGCAATTCCCTCCTATGTATGAAGAGAATTCCAGGGATAACCCCTTTAAA
CGCACAAATGAAATAGTGGAGGAACAATATACTCCTCAAAGCCTTGCTACATTGGAATCT
GTCTTCCAAGAGCTGGGGAAACTGACAGGACCAAACAACCAGAAACGTGAGAGGATGGAT
GAGGAGCAAAAACTTTATACGGATGATGAAGATGATATCTACAAGGCTAATAACATTGCC
TATGAAGATGTGGTCGGGGGAGAAGACTGGAACCCAGTAGAGGAGAAAATAGAGAGTCAA
ACCCAGGAAGAGGTGAGAGACAGCAAAGAGAATATAGAAAAAAATGAACAAATCAACGAT
GAGATGAAACGCTCAGGGCAGCTTGGCATCCAGGAAGAAGATCTTCGGAAAGAGAGTAAA
GACCAACTCTCAGATGATGTCTCCAAAGTAATTGCCTATTTGAAAAGGTTAGTAAATGCT
GCAGGAAGTGGGAGGTTACAGAATGGGCAAAATGGGGAAAGGGCCACCAGGCTTTTTGAG
AAACCTCTTGATTCTCAGTCTATTTATCAGCTGATTGAAATCTCAAGGAATTTACAGATA
CCCCCAGAAGACTTAATTGAGATGCTCAAAACTGGGGAGAAGCCGAATGGATCAGTGGAA
CCGGAGCGGGAGCTTGACCTTCCTGTTGACCTAGATGACATCTCAGAGGCTGACTTAGAC
CATCCAGACCTGTTCCAAAATAGGATGCTCTCCAAGAGTGGCTACCCTAAAACACCTGGT
CGTGCTGGGACTGAGGCCCTACCAGACGGGCTCAGTGTTGAGGATATTTTAAATCTTTTA
GGGATGGAGAGTGCAGCAAATCAGAAAACGTCGTATTTTCCCAATCCATATAACCAGGAG
AAAGTTCTGCCAAGGCTCCCTTATGGTGCTGGAAGATCTAGATCGAACCAGCTTCCCAAA
GCTGCCTGGATTCCACATGTTGAAAACAGACAGATGGCATATGAAAACCTGAACGACAAG
GATCAAGAATTAGGTGAGTACTTGGCCAGGATGCTAGTTAAATACCCTGAGATCATTAAT
TCAAACCAAGTGAAGCGAGTTCCTGGTCAAGGCTCATCTGAAGATGACCTGCAGGAAGAG
GAACAAATTGAGCAGGCCATCAAAGAGCATTTGAATCAAGGCAGCTCTCAGGAGACTGAC
AAGCTGGCCCCGGTGAGCAAAAGGTTCCCTGTGGGGCCCCCGAAGAATGATGATACCCCA
AATAGGCAGTACTGGGATGAAGATCTGTTAATGAAAGTGCTGGAATACCTCAACCAAGAA
AAGGCAGAAAAGGGAAGGGAGCATATTGCTAAGAGAGCAATGGAAAATATGTAA
Protein Properties
Number of Residues 617
Molecular Weight 70940.2
Theoretical pI 4.39
Pfam Domain Function
Signals
  • 1-27
Transmembrane Regions
  • None
Protein Sequence
>Secretogranin-2
MAEAKTHWLGAALSLIPLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALE
YIENLRQQAHKEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ
AENEPQSAPKENKPYALNSEKNFPMDMSDDYETQQWPERKLKHMQFPPMYEENSRDNPFK
RTNEIVEEQYTPQSLATLESVFQELGKLTGPNNQKRERMDEEQKLYTDDEDDIYKANNIA
YEDVVGGEDWNPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESK
DQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERATRLFEKPLDSQSIYQLIEISRNLQI
PPEDLIEMLKTGEKPNGSVEPERELDLPVDLDDISEADLDHPDLFQNRMLSKSGYPKTPG
RAGTEALPDGLSVEDILNLLGMESAANQKTSYFPNPYNQEKVLPRLPYGAGRSRSNQLPK
AAWIPHVENRQMAYENLNDKDQELGEYLARMLVKYPEIINSNQVKRVPGQGSSEDDLQEE
EQIEQAIKEHLNQGSSQETDKLAPVSKRFPVGPPKNDDTPNRQYWDEDLLMKVLEYLNQE
KAEKGREHIAKRAMENM
GenBank ID Protein 62988856
UniProtKB/Swiss-Prot ID P13521
UniProtKB/Swiss-Prot Entry Name SCG2_HUMAN
PDB IDs Not Available
GenBank Gene ID AC012512
GeneCard ID SCG2
GenAtlas ID SCG2
HGNC ID HGNC:10575
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Beranova-Giorgianni S, Zhao Y, Desiderio DM, Giorgianni F: Phosphoproteomic analysis of the human pituitary. Pituitary. 2006;9(2):109-20. [PubMed:16807684 ]
  5. Gerdes HH, Rosa P, Phillips E, Baeuerle PA, Frank R, Argos P, Huttner WB: The primary structure of human secretogranin II, a widespread tyrosine-sulfated secretory granule protein that exhibits low pH- and calcium-induced aggregation. J Biol Chem. 1989 Jul 15;264(20):12009-15. [PubMed:2745426 ]
  6. Leitner B, Schneitler C, Klocker H, Volknandt W, Zimmermann H, Winkler H, Fischer-Colbrie R: Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains. Neurosci Lett. 1998 May 29;248(2):105-8. [PubMed:9654353 ]