You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP07998
Secondary Accession Numbers
  • 13709
Name Sodium/hydrogen exchanger 6
Synonyms
  1. NHE-6
  2. Na(+)/H(+) exchanger 6
  3. Solute carrier family 9 member 6
Gene Name SLC9A6
Protein Type Unknown
Biological Properties
General Function Involved in solute:hydrogen antiporter activity
Specific Function Electroneutral exchange of protons for Na(+) and K(+) across the early and recycling endosome membranes. Contributes to calcium homeostasis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
monovalent cation:hydrogen antiporter activity
sodium:hydrogen antiporter activity
solute:cation antiporter activity
solute:hydrogen antiporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
transporter activity
Process
cation homeostasis
monovalent inorganic cation homeostasis
regulation of ph
sodium ion transport
establishment of localization
transport
biological regulation
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
Cellular Location
  1. Endosome membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs SLC9A6
Gene Sequence
>2010 bp
ATGGCTCGGCGCGGCTGGCGGCGGGCACCCCTCCGCCGTGGCGTCGGCAGCAGTCCCCGA
GCCCGCAGGCTCATGCGGCCCCTTTGGTTGCTCCTCGCAGTGGGCGTCTTTGACTGGGCA
GGGGCTTCGGACGGCGGCGGCGGAGAGGCTAGAGCCATGGACGAGGAGATCGTGTCCGAG
AAGCAAGCCGAGGAGAGCCACCGGCAGGACAGCGCCAACCTGCTCATCTTCATCCTGCTG
CTCACCCTCACCATTCTCACAATCTGGCTCTTCAAGCACCGCCGGGCCCGCTTCCTGCAC
GAAACCGGCCTGGCTATGATTTATGGTCTTTTGGTGGGCCTTGTGCTTCGGTATGGCATT
CATGTTCCGAGTGATGTAAATAATGTGACCCTGAGCTGTGAAGTGCAGTCAAGTCCAACT
ACCTTACTGGTTACTTTTGATCCAGAAGTATTTTTCAACATATTACTTCCTCCTATCATA
TTTTATGCAGGTTATAGCCTGAAAAGGAGACATTTTTTTCGAAATCTTGGGTCTATCCTA
GCATACGCTTTTCTTGGAACAGCAATTTCTTGTTTCGTTATTGGGTCAATAATGTATGGC
TGTGTAACGCTGATGAAGGTAACGGGACAACTTGCAGGAGATTTTTACTTTACAGATTGC
CTACTGTTTGGTGCCATTGTATCAGCAACTGATCCAGTGACTGTTCTTGCTATATTCCAC
GAGCTTCAAGTTGATGTTGAACTCTATGCACTTCTTTTTGGTGAAAGTGTCCTCAATGAT
GCTGTTGCCATAGTGCTGTCCTCCTCAATAGTGGCATACCAGCCAGCTGGAGACAACAGT
CACACCTTTGATGTCACAGCGATGTTCAAGTCTATTGGGATCTTCCTTGGAATCTTCAGT
GGATCTTTTGCAATGGGTGCTGCTACTGGAGTGGTGACAGCTTTAGTGACAAAGTTCACC
AAATTACGGGAGTTCCAGTTGTTGGAGACAGGCCTGTTCTTCTTGATGTCCTGGAGTACC
TTCCTCTTGGCTGAAGCATGGGGCTTCACAGGTGTAGTTGCAGTATTGTTTTGTGGCATC
ACACAAGCACATTATACGTATAATAATTTGTCCACGGAGTCTCAGCATAGAACTAAACAG
TTGTTTGAGCTTCTCAATTTCTTGGCAGAGAATTTCATCTTCTCCTACATGGGGCTGACA
CTGTTCACCTTCCAGAACCATGTCTTTAACCCAACATTTGTAGTAGGAGCATTTGTTGCT
ATTTTCTTGGGAAGAGCTGCCAATATTTACCCCTTGTCCCTCTTACTTAATTTGGGTAGA
AGAAGTAAGATTGGATCAAATTTTCAACACATGATGATGTTTGCTGGCCTTCGTGGTGCA
ATGGCATTTGCCTTGGCCATTCGAGATACTGCCACTTATGCACGGCAAATGATGTTCAGC
ACCACGCTTCTGATTGTGTTTTTTACCGTGTGGGTATTTGGTGGTGGCACCACTGCAATG
CTGTCATGCTTGCATATCAGGGTTGGTGTTGATTCAGACCAAGAACACTTGGGTGTTCCT
GAAAATGAAAGGAGAACTACCAAAGCAGAGAGTGCTTGGCTTTTCCGGATGTGGTACAAC
TTTGATCATAACTATCTGAAGCCTCTGCTGACCCACAGCGGGCCTCCGCTGACAACAACA
CTCCCTGCCTGCTGTGGACCCATCGCCAGGTGCCTCACCAGCCCCCAGGCTTACGAAAAC
CAGGAACAGTTGAAAGATGATGATTCTGATCTTATTCTCAATGATGGTGACATCAGTTTG
ACATATGGAGATTCTACTGTGAACACTGAACCGGCCACATCCAGCGCCCCAAGGAGATTT
ATGGGAAACAGTTCTGAAGATGCCTTGGATCGGGAGCTTGCATTTGGGGACCATGAACTG
GTCATTCGAGGAACACGCCTGGTTCTTCCAATGGATGATTCTGAACCCCCGCTAAATTTG
TTAGATAATACGAGACATGGTCCAGCCTAA
Protein Properties
Number of Residues 669
Molecular Weight 74160.8
Theoretical pI 6.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 28-48
  • 71-91
  • 103-123
  • 142-162
  • 179-199
  • 220-240
  • 246-266
  • 292-312
  • 340-360
  • 382-402
  • 404-424
  • 447-467
  • 483-503
Protein Sequence
>Sodium/hydrogen exchanger 6
MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASDGGGGEARAMDEEIVSE
KQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGI
HVPSDVNNVTLSCEVQSSPTTLLVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSIL
AYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFH
ELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFS
GSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGI
TQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVA
IFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFS
TTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAWLFRMWYN
FDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISL
TYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNL
LDNTRHGPA
GenBank ID Protein 2944233
UniProtKB/Swiss-Prot ID Q92581
UniProtKB/Swiss-Prot Entry Name SL9A6_HUMAN
PDB IDs Not Available
GenBank Gene ID AF030409
GeneCard ID SLC9A6
GenAtlas ID SLC9A6
HGNC ID HGNC:11079
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  3. Ross MT, Grafham DV, Coffey AJ, Scherer S, McLay K, Muzny D, Platzer M, Howell GR, Burrows C, Bird CP, Frankish A, Lovell FL, Howe KL, Ashurst JL, Fulton RS, Sudbrak R, Wen G, Jones MC, Hurles ME, Andrews TD, Scott CE, Searle S, Ramser J, Whittaker A, Deadman R, Carter NP, Hunt SE, Chen R, Cree A, Gunaratne P, Havlak P, Hodgson A, Metzker ML, Richards S, Scott G, Steffen D, Sodergren E, Wheeler DA, Worley KC, Ainscough R, Ambrose KD, Ansari-Lari MA, Aradhya S, Ashwell RI, Babbage AK, Bagguley CL, Ballabio A, Banerjee R, Barker GE, Barlow KF, Barrett IP, Bates KN, Beare DM, Beasley H, Beasley O, Beck A, Bethel G, Blechschmidt K, Brady N, Bray-Allen S, Bridgeman AM, Brown AJ, Brown MJ, Bonnin D, Bruford EA, Buhay C, Burch P, Burford D, Burgess J, Burrill W, Burton J, Bye JM, Carder C, Carrel L, Chako J, Chapman JC, Chavez D, Chen E, Chen G, Chen Y, Chen Z, Chinault C, Ciccodicola A, Clark SY, Clarke G, Clee CM, Clegg S, Clerc-Blankenburg K, Clifford K, Cobley V, Cole CG, Conquer JS, Corby N, Connor RE, David R, Davies J, Davis C, Davis J, Delgado O, Deshazo D, Dhami P, Ding Y, Dinh H, Dodsworth S, Draper H, Dugan-Rocha S, Dunham A, Dunn M, Durbin KJ, Dutta I, Eades T, Ellwood M, Emery-Cohen A, Errington H, Evans KL, Faulkner L, Francis F, Frankland J, Fraser AE, Galgoczy P, Gilbert J, Gill R, Glockner G, Gregory SG, Gribble S, Griffiths C, Grocock R, Gu Y, Gwilliam R, Hamilton C, Hart EA, Hawes A, Heath PD, Heitmann K, Hennig S, Hernandez J, Hinzmann B, Ho S, Hoffs M, Howden PJ, Huckle EJ, Hume J, Hunt PJ, Hunt AR, Isherwood J, Jacob L, Johnson D, Jones S, de Jong PJ, Joseph SS, Keenan S, Kelly S, Kershaw JK, Khan Z, Kioschis P, Klages S, Knights AJ, Kosiura A, Kovar-Smith C, Laird GK, Langford C, Lawlor S, Leversha M, Lewis L, Liu W, Lloyd C, Lloyd DM, Loulseged H, Loveland JE, Lovell JD, Lozado R, Lu J, Lyne R, Ma J, Maheshwari M, Matthews LH, McDowall J, McLaren S, McMurray A, Meidl P, Meitinger T, Milne S, Miner G, Mistry SL, Morgan M, Morris S, Muller I, Mullikin JC, Nguyen N, Nordsiek G, Nyakatura G, O'Dell CN, Okwuonu G, Palmer S, Pandian R, Parker D, Parrish J, Pasternak S, Patel D, Pearce AV, Pearson DM, Pelan SE, Perez L, Porter KM, Ramsey Y, Reichwald K, Rhodes S, Ridler KA, Schlessinger D, Schueler MG, Sehra HK, Shaw-Smith C, Shen H, Sheridan EM, Shownkeen R, Skuce CD, Smith ML, Sotheran EC, Steingruber HE, Steward CA, Storey R, Swann RM, Swarbreck D, Tabor PE, Taudien S, Taylor T, Teague B, Thomas K, Thorpe A, Timms K, Tracey A, Trevanion S, Tromans AC, d'Urso M, Verduzco D, Villasana D, Waldron L, Wall M, Wang Q, Warren J, Warry GL, Wei X, West A, Whitehead SL, Whiteley MN, Wilkinson JE, Willey DL, Williams G, Williams L, Williamson A, Williamson H, Wilming L, Woodmansey RL, Wray PW, Yen J, Zhang J, Zhou J, Zoghbi H, Zorilla S, Buck D, Reinhardt R, Poustka A, Rosenthal A, Lehrach H, Meindl A, Minx PJ, Hillier LW, Willard HF, Wilson RK, Waterston RH, Rice CM, Vaudin M, Coulson A, Nelson DL, Weinstock G, Sulston JE, Durbin R, Hubbard T, Gibbs RA, Beck S, Rogers J, Bentley DR: The DNA sequence of the human X chromosome. Nature. 2005 Mar 17;434(7031):325-37. [PubMed:15772651 ]
  4. Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265 ]
  5. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502 ]
  6. Numata M, Petrecca K, Lake N, Orlowski J: Identification of a mitochondrial Na+/H+ exchanger. J Biol Chem. 1998 Mar 20;273(12):6951-9. [PubMed:9507001 ]
  7. Brett CL, Wei Y, Donowitz M, Rao R: Human Na(+)/H(+) exchanger isoform 6 is found in recycling endosomes of cells, not in mitochondria. Am J Physiol Cell Physiol. 2002 May;282(5):C1031-41. [PubMed:11940519 ]
  8. Gilfillan GD, Selmer KK, Roxrud I, Smith R, Kyllerman M, Eiklid K, Kroken M, Mattingsdal M, Egeland T, Stenmark H, Sjoholm H, Server A, Samuelsson L, Christianson A, Tarpey P, Whibley A, Stratton MR, Futreal PA, Teague J, Edkins S, Gecz J, Turner G, Raymond FL, Schwartz C, Stevenson RE, Undlien DE, Stromme P: SLC9A6 mutations cause X-linked mental retardation, microcephaly, epilepsy, and ataxia, a phenotype mimicking Angelman syndrome. Am J Hum Genet. 2008 Apr;82(4):1003-10. doi: 10.1016/j.ajhg.2008.01.013. Epub 2008 Mar 13. [PubMed:18342287 ]