You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08007
Secondary Accession Numbers
  • 13718
Name Sarcoplasmic reticulum histidine-rich calcium-binding protein
Synonyms Not Available
Gene Name HRC
Protein Type Unknown
Biological Properties
General Function Involved in calcium ion binding
Specific Function May play a role in the regulation of calcium sequestration or release in the SR of skeletal and cardiac muscle
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Sarcoplasmic reticulum lumen
Gene Properties
Chromosome Location Chromosome:1
Locus 19q13.3
SNPs HRC
Gene Sequence
>2100 bp
ATGGGCCACCATAGGCCATGGCTGCACGCTTCTGTCCTCTGGGCTGGGGTGGCCAGCCTG
CTCCTCCCCCCGGCCATGACCCAGCAGCTCAGAGGGGATGGGCTAGGCTTCAGAAACCGG
AACAACAGCACTGGAGTCGCCGGGCTCTCCGAGGAGGCATCAGCAGAGCTTCGCCACCAC
CTCCACAGCCCTAGAGACCATCCAGATGAGAACAAGGATGTTTCCACAGAGAATGGGCAT
CATTTCTGGAGCCACCCAGACCGTGAAAAGGAGGATGAAGATGTCTCCAAGGAATATGGG
CACCTACTCCCAGGCCACAGGTCCCAAGACCACAAAGTCGGAGATGAGGGTGTCTCAGGT
GAGGAGGTCTTTGCAGAGCATGGTGGGCAGGCCCGTGGGCACAGAGGCCACGGGAGTGAA
GACACGGAAGACTCAGCTGAGCACAGGCACCACCTCCCCAGCCACAGGAGCCACAGCCAT
CAAGACGAGGATGAGGATGAAGTTGTGTCCAGTGAGCATCACCATCATATCCTCAGGCAT
GGACACCGAGGCCATGATGGGGAAGATGATGAAGGAGAAGAGGAGGAGGAGGAGGAGGAG
GAGGAAGAGGAGGCCTCCACTGAGTATGGACACCAGGCCCACAGGCACCGAGGCCATGGG
AGTGAAGAGGATGAGGATGTCTCAGATGGACACCATCATCATGGCCCCAGCCACAGGCAC
CAAGGCCATGAAGAAGATGACGATGATGATGATGATGATGATGATGATGATGATGATGAT
GATGTCTCCATTGAATATAGACACCAGGCTCACAGGCACCAAGGCCACGGGATTGAAGAG
GATGAAGATGTCTCAGATGGACACCATCATCGCGACCCCAGCCACAGGCACCGAAGCCAT
GAAGAAGATGACAATGATGATGATGATGTCTCCACTGAGTATGGACACCAGGCCCACAGG
CACCAAGACCACAGAAAGGAAGAGGTTGAGGCTGTCTCAGGTGAACACCACCATCATGTC
CCTGACCACAGGCACCAAGGCCACAGAGACGAGGAAGAAGATGAGGATGTGTCCACTGAA
CGTTGGCACCAGGGTCCCCAACATGTCCACCATGGCCTTGTAGATGAGGAAGAGGAAGAA
GAGGAGATCACAGTCCAGTTCGGCCACTATGTTGCAAGCCACCAACCTCGAGGCCACAAG
AGTGATGAAGAGGACTTCCAAGATGAGTATAAAACAGAAGTCCCTCACCATCACCACCAC
AGAGTCCCCAGGGAGGAAGATGAGGAGGTCTCTGCTGAGCTTGGCCACCAGGCCCCCAGC
CACAGGCAAAGCCACCAAGATGAAGAAACTGGCCATGGTCAAAGAGGGTCCATCAAAGAG
ATGAGCCATCACCCCCCAGGACACACAGTGGTCAAGGATAGAAGCCATTTGAGGAAGGAT
GATTCTGAGGAGGAAAAGGAGAAGGAAGAGGACCCCGGCTCCCATGAGGAAGACGATGAA
AGTTCAGAGCAGGGAGAGAAAGGCACCCATCATGGCAGCCGGGACCAGGAAGATGAGGAG
GATGAGGAGGAAGGTCATGGCCTCAGCCTGAACCAGGAGGAGGAAGAAGAGGAAGACAAG
GAGGAGGAGGAGGAGGAAGAAGACGAGGAGAGGAGGGAAGAGAGGGCTGAGGTTGGGGCC
CCACTGAGCCCAGACCACAGCGAGGAGGAAGAGGAGGAGGAGGAGGGGCTGGAGGAAGAT
GAGCCCCGCTTCACCATCATCCCCAACCCACTGGACAGGAGAGAGGAGGCTGGAGGTGCC
TCCAGCGAGGAGGAAAGCGGTGAGGACACAGGTCCACAGGATGCTCAGGAGTATGGGAAC
TACCAGCCAGGGTCCCTGTGTGGCTACTGCTCCTTCTGCAATCGATGCACTGAATGTGAG
AGCTGTCACTGTGATGAGGAGAACATGGGTGAGCACTGCGACCAGTGCCAGCACTGTCAG
TTCTGCTATCTCTGCCCGCTGGTCTGCGAAACGGTCTGCGCTCCAGGAAGCTACGTTGAC
TATTTCTCCTCGTCCCTTTATCAGGCCCTGGCAGACATGCTGGAAACGCCGGAACCCTGA
Protein Properties
Number of Residues 699
Molecular Weight 80243.5
Theoretical pI 4.36
Pfam Domain Function
Signals
  • 1-28
Transmembrane Regions
  • None
Protein Sequence
>Sarcoplasmic reticulum histidine-rich calcium-binding protein
MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHH
LHSPRDHPDENKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSG
EEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRH
GHRGHDGEDDEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRH
QGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSH
EEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRDEEEDEDVSTE
RWHQGPQHVHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHH
RVPREEDEEVSAELGHQAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKD
DSEEEKEKEEDPGSHEEDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDK
EEEEEEEDEERREERAEVGAPLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGA
SSEEESGEDTGPQDAQEYGNYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQ
FCYLCPLVCETVCAPGSYVDYFSSSLYQALADMLETPEP
GenBank ID Protein 46854902
UniProtKB/Swiss-Prot ID P23327
UniProtKB/Swiss-Prot Entry Name SRCH_HUMAN
PDB IDs Not Available
GenBank Gene ID BC069795
GeneCard ID HRC
GenAtlas ID HRC
HGNC ID HGNC:5178
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hofmann SL, Topham M, Hsieh CL, Francke U: cDNA and genomic cloning of HRC, a human sarcoplasmic reticulum protein, and localization of the gene to human chromosome 19 and mouse chromosome 7. Genomics. 1991 Apr;9(4):656-69. [PubMed:2037293 ]