You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08015
Secondary Accession Numbers
  • 13726
Name Stromal interaction molecule 1
Synonyms Not Available
Gene Name STIM1
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function Plays a role in mediating Ca(2+) influx following depletion of intracellular Ca(2+) stores. Acts as Ca(2+) sensor in the endoplasmic reticulum via its EF-hand domain. Upon Ca(2+) depletion, translocates from the endoplasmic reticulum to the plasma membrane where it activates the Ca(2+) release-activated Ca(2+) (CRAC) channel subunit, TMEM142A/ORAI1
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Endoplasmic reticulum membrane
  3. Single-pass type I membrane protein
  4. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.5
SNPs STIM1
Gene Sequence
>2058 bp
ATGGATGTATGCGTCCGTCTTGCCCTGTGGCTCCTCTGGGGACTCCTCCTGCACCAGGGC
CAGAGCCTCAGCCATAGTCACAGTGAGAAGGCGACAGGAACCAGCTCGGGGGCCAACTCT
GAGGAGTCCACTGCAGCAGAGTTTTGCCGAATTGACAAGCCCCTGTGTCACAGTGAGGAT
GAGAAACTCAGCTTCGAGGCAGTCCGTAACATCCACAAACTGATGGACGATGATGCCAAT
GGTGATGTGGATGTGGAAGAAAGTGATGAGTTCCTGAGGGAAGACCTCAATTACCATGAC
CCAACAGTGAAACACAGCACCTTCCATGGTGAGGATAAGCTCATCAGCGTGGAGGACCTG
TGGAAGGCATGGAAGTCATCAGAAGTATACAATTGGACCGTGGATGAGGTGGTACAGTGG
CTGATCACATATGTGGAGCTGCCTCAGTATGAGGAGACCTTCCGGAAGCTGCAGCTCAGT
GGCCATGCCATGCCAAGGCTGGCTGTCACCAACACCACCATGACAGGGACTGTGCTGAAG
ATGACAGACCGGAGTCATCGGCAGAAGCTGCAGCTGAAGGCTCTGGATACAGTGCTCTTT
GGGCCTCCTCTCTTGACTCGCCATAATCACCTCAAGGACTTCATGCTGGTGGTGTCTATC
GTTATTGGTGTGGGCGGCTGCTGGTTTGCCTATATCCAGAACCGTTACTCCAAGGAGCAC
ATGAAGAAGATGATGAAGGACTTGGAGGGGTTACACCGAGCTGAGCAGAGTCTGCATGAC
CTTCAGGAAAGGCTGCACAAGGCCCAGGAGGAGCACCGCACAGTGGAGGTGGAGAAGGTC
CATCTGGAAAAGAAGCTGCGCGATGAGATCAACCTTGCTAAGCAGGAAGCCCAGCGGCTG
AAGGAGCTGCGGGAGGGTACTGAGAATGAGCGGAGCCGCCAAAAATATGCTGAGGAGGAG
TTGGAGCAGGTTCGGGAGGCCTTGAGGAAAGCAGAGAAGGAGCTAGAATCTCACAGCTCA
TGGTATGCTCCAGAGGCCCTTCAGAAGTGGCTGCAGCTGACACATGAGGTGGAGGTGCAA
TATTACAACATCAAGAAGCAAAATGCTGAGAAGCAGCTGCTGGTGGCCAAGGAGGGGGCT
GAGAAGATAAAAAAGAAGAGAAACACACTCTTTGGCACCTTCCACGTGGCCCACAGCTCT
TCCCTGGATGATGTAGATCATAAAATTCTAACAGCTAAGCAAGCACTGAGCGAGGTGACA
GCAGCATTGCGGGAGCGCCTGCACCGCTGGCAACAGATCGAGATCCTCTGTGGCTTCCAG
ATTGTCAACAACCCTGGCATCCACTCACTGGTGGCTGCCCTCAACATAGACCCCAGCTGG
ATGGGCAGTACACGCCCCAACCCTGCTCACTTCATCATGACTGACGACGTGGATGACATG
GATGAGGAGATTGTGTCTCCCTTGTCCATGCAGTCCCCTAGCCTGCAGAGCAGTGTTCGG
CAGCGCCTGACGGAGCCACAGCATGGCCTGGGATCTCAGAGGGATTTGACCCATTCCGAT
TCGGAGTCCTCCCTCCACATGAGTGACCGCCAGCGTGTGGCCCCCAAACCTCCTCAGATG
AGCCGTGCTGCAGACGAGGCTCTCAATGCCATGACTTCCAATGGCAGCCACCGGCTGATC
GAGGGGGTCCACCCAGGGTCTCTGGTGGAGAAACTGCCTGACAGCCCTGCCCTGGCCAAG
AAGGCATTACTGGCGCTGAACCATGGGCTGGACAAGGCCCACAGCCTGATGGAGCTGAGC
CCCTCAGCCCCACCTGGTGGCTCTCCACATTTGGATTCTTCCCGTTCTCACAGCCCCAGC
TCCCCAGACCCAGACACACCATCTCCAGTTGGGGACAGCCGAGCCCTGCAAGCCAGCCGA
AACACACGCATTCCCCACCTGGCTGGCAAGAAGGCTGTGGCTGAGGAGGATAATGGCTCT
ATTGGCGAGGAAACAGACTCCAGCCCAGGCCGGAAGAAGTTTCCCCTCAAAATCTTTAAG
AAGCCTCTTAAGAAGTAG
Protein Properties
Number of Residues 685
Molecular Weight 77422.8
Theoretical pI 6.65
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 214-234
Protein Sequence
>Stromal interaction molecule 1
MDVCVRLALWLLWGLLLHQGQSLSHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSED
EKLSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDL
WKAWKSSEVYNWTVDEVVQWLITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGTVLK
MTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVVSIVIGVGGCWFAYIQNRYSKEH
MKKMMKDLEGLHRAEQSLHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQEAQRL
KELREGTENERSRQKYAEEELEQVREALRKAEKELESHSSWYAPEALQKWLQLTHEVEVQ
YYNIKKQNAEKQLLVAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAKQALSEVT
AALRERLHRWQQIEILCGFQIVNNPGIHSLVAALNIDPSWMGSTRPNPAHFIMTDDVDDM
DEEIVSPLSMQSPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDRQRVAPKPPQM
SRAADEALNAMTSNGSHRLIEGVHPGSLVEKLPDSPALAKKALLALNHGLDKAHSLMELS
PSAPPGGSPHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHLAGKKAVAEEDNGS
IGEETDSSPGRKKFPLKIFKKPLKK
GenBank ID Protein 20987365
UniProtKB/Swiss-Prot ID Q13586
UniProtKB/Swiss-Prot Entry Name STIM1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC021300
GeneCard ID STIM1
GenAtlas ID STIM1
HGNC ID HGNC:11386
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  7. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  8. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Zhang H, Li XJ, Martin DB, Aebersold R: Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry. Nat Biotechnol. 2003 Jun;21(6):660-6. Epub 2003 May 18. [PubMed:12754519 ]
  11. Lewandrowski U, Moebius J, Walter U, Sickmann A: Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach. Mol Cell Proteomics. 2006 Feb;5(2):226-33. Epub 2005 Oct 31. [PubMed:16263699 ]
  12. Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J: Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment. J Proteome Res. 2008 Dec;7(12):5167-76. [PubMed:19367720 ]
  13. Parker NJ, Begley CG, Smith PJ, Fox RM: Molecular cloning of a novel human gene (D11S4896E) at chromosomal region 11p15.5. Genomics. 1996 Oct 15;37(2):253-6. [PubMed:8921403 ]
  14. Sabbioni S, Barbanti-Brodano G, Croce CM, Negrini M: GOK: a gene at 11p15 involved in rhabdomyosarcoma and rhabdoid tumor development. Cancer Res. 1997 Oct 15;57(20):4493-7. [PubMed:9377559 ]
  15. Manji SS, Parker NJ, Williams RT, van Stekelenburg L, Pearson RB, Dziadek M, Smith PJ: STIM1: a novel phosphoprotein located at the cell surface. Biochim Biophys Acta. 2000 Aug 31;1481(1):147-55. [PubMed:11004585 ]
  16. Williams RT, Manji SS, Parker NJ, Hancock MS, Van Stekelenburg L, Eid JP, Senior PV, Kazenwadel JS, Shandala T, Saint R, Smith PJ, Dziadek MA: Identification and characterization of the STIM (stromal interaction molecule) gene family: coding for a novel class of transmembrane proteins. Biochem J. 2001 Aug 1;357(Pt 3):673-85. [PubMed:11463338 ]
  17. Williams RT, Senior PV, Van Stekelenburg L, Layton JE, Smith PJ, Dziadek MA: Stromal interaction molecule 1 (STIM1), a transmembrane protein with growth suppressor activity, contains an extracellular SAM domain modified by N-linked glycosylation. Biochim Biophys Acta. 2002 Apr 1;1596(1):131-7. [PubMed:11983428 ]
  18. Liou J, Kim ML, Heo WD, Jones JT, Myers JW, Ferrell JE Jr, Meyer T: STIM is a Ca2+ sensor essential for Ca2+-store-depletion-triggered Ca2+ influx. Curr Biol. 2005 Jul 12;15(13):1235-41. [PubMed:16005298 ]
  19. Roos J, DiGregorio PJ, Yeromin AV, Ohlsen K, Lioudyno M, Zhang S, Safrina O, Kozak JA, Wagner SL, Cahalan MD, Velicelebi G, Stauderman KA: STIM1, an essential and conserved component of store-operated Ca2+ channel function. J Cell Biol. 2005 May 9;169(3):435-45. Epub 2005 May 2. [PubMed:15866891 ]
  20. Zhang SL, Yu Y, Roos J, Kozak JA, Deerinck TJ, Ellisman MH, Stauderman KA, Cahalan MD: STIM1 is a Ca2+ sensor that activates CRAC channels and migrates from the Ca2+ store to the plasma membrane. Nature. 2005 Oct 6;437(7060):902-5. [PubMed:16208375 ]
  21. Mercer JC, Dehaven WI, Smyth JT, Wedel B, Boyles RR, Bird GS, Putney JW Jr: Large store-operated calcium selective currents due to co-expression of Orai1 or Orai2 with the intracellular calcium sensor, Stim1. J Biol Chem. 2006 Aug 25;281(34):24979-90. Epub 2006 Jun 28. [PubMed:16807233 ]
  22. Soboloff J, Spassova MA, Tang XD, Hewavitharana T, Xu W, Gill DL: Orai1 and STIM reconstitute store-operated calcium channel function. J Biol Chem. 2006 Jul 28;281(30):20661-5. Epub 2006 Jun 9. [PubMed:16766533 ]
  23. Peinelt C, Vig M, Koomoa DL, Beck A, Nadler MJ, Koblan-Huberson M, Lis A, Fleig A, Penner R, Kinet JP: Amplification of CRAC current by STIM1 and CRACM1 (Orai1). Nat Cell Biol. 2006 Jul;8(7):771-3. Epub 2006 May 30. [PubMed:16733527 ]
  24. Spassova MA, Soboloff J, He LP, Xu W, Dziadek MA, Gill DL: STIM1 has a plasma membrane role in the activation of store-operated Ca(2+) channels. Proc Natl Acad Sci U S A. 2006 Mar 14;103(11):4040-5. Epub 2006 Mar 6. [PubMed:16537481 ]
  25. Parvez S, Beck A, Peinelt C, Soboloff J, Lis A, Monteilh-Zoller M, Gill DL, Fleig A, Penner R: STIM2 protein mediates distinct store-dependent and store-independent modes of CRAC channel activation. FASEB J. 2008 Mar;22(3):752-61. Epub 2007 Sep 28. [PubMed:17905723 ]
  26. Honnappa S, Gouveia SM, Weisbrich A, Damberger FF, Bhavesh NS, Jawhari H, Grigoriev I, van Rijssel FJ, Buey RM, Lawera A, Jelesarov I, Winkler FK, Wuthrich K, Akhmanova A, Steinmetz MO: An EB1-binding motif acts as a microtubule tip localization signal. Cell. 2009 Jul 23;138(2):366-76. doi: 10.1016/j.cell.2009.04.065. [PubMed:19632184 ]
  27. Picard C, McCarl CA, Papolos A, Khalil S, Luthy K, Hivroz C, LeDeist F, Rieux-Laucat F, Rechavi G, Rao A, Fischer A, Feske S: STIM1 mutation associated with a syndrome of immunodeficiency and autoimmunity. N Engl J Med. 2009 May 7;360(19):1971-80. doi: 10.1056/NEJMoa0900082. [PubMed:19420366 ]
  28. Srikanth S, Jung HJ, Kim KD, Souda P, Whitelegge J, Gwack Y: A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells. Nat Cell Biol. 2010 May;12(5):436-46. doi: 10.1038/ncb2045. Epub 2010 Apr 25. [PubMed:20418871 ]