You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08023
Secondary Accession Numbers
  • 13734
Name Synapsin-3
Synonyms
  1. Synapsin III
Gene Name SYN3
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function May be involved in the regulation of neurotransmitter release and synaptogenesis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
organelle
vesicle
Function
binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
Process
neurotransmitter secretion
biological regulation
regulation of biological quality
regulation of neurotransmitter levels
Cellular Location
  1. Peripheral membrane protein
  2. Cytoplasmic vesicle
  3. Cytoplasmic side
  4. secretory vesicle
  5. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:2
Locus 22q12.3
SNPs SYN3
Gene Sequence
>1743 bp
ATGAATTTCCTCCGGCGACGTCTCTCTGACAGCAGCTTCATGGCCAACCTGCCTAATGGC
TATATGACGGACCTGCAACGCCCAGATAGCTCCACCAGCTCACCTGCTTCCCCCGCCATG
GAGAGGAGGCACCCCCAGCCCCTGGCTGCCTCCTTCTCCTCTCCAGGATCCAGCCTTTTT
AGCTCCCTCTCCAGTGCCATGAAGCAGGCCCCTCAGGCCACCTCAGGACTGATGGAGCCT
CCAGGTCCCTCCACGCCCATTGTTCAAAGACCCAGGATCCTGTTGGTGATCGATGATGCC
CATACAGACTGGTCGAAGTATTTCCATGGGAAGAAGGTGAATGGAGAGATTGAGATCCGA
GTGGAGCAGGCTGAATTCTCAGAGTTGAACCTAGCTGCCTATGTGACCGGGGGCTGCATG
GTGGACATGCAGGTCGTGAGAAATGGGACCAAAGTGGTGAGCAGATCCTTCAAGCCAGAC
TTCATCCTGGTCCGCCAGCATGCCTACAGCATGGCCCTGGGGGAAGACTACCGCAGCCTG
GTCATCGGCCTGCAGTATGGAGGGCTGCCTGCTGTCAACTCTCTCTACTCCGTCTACAAC
TTCTGCAGCAAGCCCTGGGTGTTCTCTCAGCTCATTAAGATCTTCCATTCCCTGGGTCCT
GAGAAGTTCCCGCTTGTGGAGCAAACATTTTTCCCCAACCATAAGCCAATGGTCACAGCC
CCACACTTCCCGGTGGTAGTCAAGCTGGGACATGCCCACGCTGGAATGGGAAAGATCAAA
GTGGAAAACCAGCTTGACTTCCAGGACATCACCAGCGTGGTCGCCATGGCCAAAACATAC
GCCACCACCGAGGCGTTCATCGACTCCAAGTACGACATCCGCATCCAGAAAATTGGATCC
AACTACAAGGCTTACATGAGAACCTCCATCTCTGGGAACTGGAAGGCCAACACAGGCTCT
GCCATGCTGGAGCAGGTGGCCATGACAGAGAGGTACAGGCTGTGGGTGGACAGCTGCTCG
GAAATGTTTGGCGGCCTGGACATCTGTGCCGTCAAGGCTGTCCACAGCAAGGATGGCAGA
GATTACATCATCGAGGTAATGGACAGCTCAATGCCGCTGATTGGAGAGCATGTGGAAGAG
GACAGACAGCTGATGGCCGACCTTGTTGTCTCCAAAATGAGCCAGCTCCCGATGCCAGGA
GGCACAGCGCCCTCCCCCCTCAGACCTTGGGCTCCACAGATTAAATCAGCGAAATCCCCA
GGGCAAGCCCAGCTGGGGCCTCAGCTAGGCCAGCCCCAGCCACGCCCACCTCCGCAAGGA
GGCCCTCGCCAAGCTCAGTCTCCTCAGCCCCAGAGATCTGGAAGCCCCTCCCAACAGAGG
CTCTCCCCACAAGGCCAGCAGCCCCTGAGCCCCCAGTCCGGATCTCCACAGCAGCAAAGG
TCACCAGGCTCTCCGCAGCTATCCCGGGCATCCAGTGGCAGCTCCCCAAACCAGGCCTCC
AAGCCAGGTGCCACCCTCGCCTCACAGCCCCGGCCCCCTGTGCAGGGCCGTAGTACCTCC
CAGCAGGGTGAAGAGTCCAAGAAGCCAGCACCACCCCATCCGCATCTCAACAAATCTCAG
TCCCTGACTAACAGCCTCAGCACATCCGACACCTCCCAGCGTGGGACCCCAAGTGAAGAC
GAGGCCAAGGCTGAAACCATCCGCAACCTGAGGAAGTCTTTTGCCAGCCTGTTCTCTGAC
TAA
Protein Properties
Number of Residues 580
Molecular Weight 63302.2
Theoretical pI 9.86
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Synapsin-3
MNFLRRRLSDSSFMANLPNGYMTDLQRPDSSTSSPASPAMERRHPQPLAASFSSPGSSLF
SSLSSAMKQAPQATSGLMEPPGPSTPIVQRPRILLVIDDAHTDWSKYFHGKKVNGEIEIR
VEQAEFSELNLAAYVTGGCMVDMQVVRNGTKVVSRSFKPDFILVRQHAYSMALGEDYRSL
VIGLQYGGLPAVNSLYSVYNFCSKPWVFSQLIKIFHSLGPEKFPLVEQTFFPNHKPMVTA
PHFPVVVKLGHAHAGMGKIKVENQLDFQDITSVVAMAKTYATTEAFIDSKYDIRIQKIGS
NYKAYMRTSISGNWKANTGSAMLEQVAMTERYRLWVDSCSEMFGGLDICAVKAVHSKDGR
DYIIEVMDSSMPLIGEHVEEDRQLMADLVVSKMSQLPMPGGTAPSPLRPWAPQIKSAKSP
GQAQLGPQLGQPQPRPPPQGGPRQAQSPQPQRSGSPSQQRLSPQGQQPLSPQSGSPQQQR
SPGSPQLSRASSGSSPNQASKPGATLASQPRPPVQGRSTSQQGEESKKPAPPHPHLNKSQ
SLTNSLSTSDTSQRGTPSEDEAKAETIRNLRKSFASLFSD
GenBank ID Protein 3090889
UniProtKB/Swiss-Prot ID O14994
UniProtKB/Swiss-Prot Entry Name SYN3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF046873
GeneCard ID SYN3
GenAtlas ID SYN3
HGNC ID HGNC:11496
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Kao HT, Porton B, Czernik AJ, Feng J, Yiu G, Haring M, Benfenati F, Greengard P: A third member of the synapsin gene family. Proc Natl Acad Sci U S A. 1998 Apr 14;95(8):4667-72. [PubMed:9539796 ]