Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08025
Secondary Accession Numbers
  • 13736
Name Synaptotagmin-10
Synonyms
  1. Synaptotagmin X
  2. SytX
Gene Name SYT10
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
membrane
cell part
organelle
vesicle
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Single-pass membrane protein
  3. secretory vesicle
  4. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12p11.1
SNPs SYT10
Gene Sequence
>1572 bp
ATGAGTTTCCACAAGGAGGACGGAGTGAACAGTCTGTGCCAGAAGGCTCTGCACATCGTC
ACCGAGCTGTGCTTCGCCGGCCAGGTGGAGTGGGAGAAGTGCTCGGGCATCTTCCCTCGG
GACAGGGGCAGCCAGGGCGGAAGCAGCACAGATATTTCAGTCAGCCTGTTAGCTGTCGTT
GTCAGCTTTTGTGGACTGGCCTTGTTGGTTGTCTCACTTTTTGTCTTCTGGAAGCTGTGT
TGGCCATGCTGGAAAAGCAAACCTGTGACTTCCAACATCACTACGCTTCCACAGAGCATT
TCAAGTGCTCCTACTGAAGTTTTTGAGACTGAAGAGAAAAAAGAAATTAAGGAAAATGAA
AAGCCAGCCGTAAAAGCTATTGAGCCTGCAATAAAAATCAGCCACACTTCCCCTGACATC
CCAGCAGAAGTCCAAACTGCTTTAAAAGAACATTTAATTAAACATGCACGTGTGCAAAGA
CAAATTACTGAGCCTACGTCATCAACCCGCCACAGTTCCTTCCGAAGACACCTGCCGAGG
CAAATGCAGGTTTCCAGTGTTGATTTTAGCATGGGCACAGAACCTGTTTTACAACGAGGA
GAAACAACAACCAGCATTGGGAGGATAAAGCCAGAACTCTACAAACAGAAATCAGTTGAC
TCTGAGGGCAACCAAAACGAAGATGTCAAAATCTGTGGGAAACTTAACTTTACCCTCCAG
TATGATTATGAAAATGAACTTCTAGTTGTTAAAATTATCAAAGCTTTAGATCTCCCTGCT
AAAGACTTCACAGGAACTTCTGACCCTTATGTGAAGATGTATCTTCTTCCAGATAGGAAA
AAGAAATTTCAGACCCGCGTGCACAGAAAGACTTTAAATCCTCTATTTGATGAAACTTTT
CAATTTCCTGTGGCATATGATCAACTAAGCAACCGAAAACTACATTTCAGTGTGTATGAT
TTTGACAGATTTTCTAGACATGACATGATTGGGGAAGTGATTCTTGATAATTTGTTTGAA
GTCTCTGATCTCTCCAGGGAAGCCACAGTATGGAAAGATATTCACTGTGCTACCACAGAA
AGTATAGACCTGGGTGAAATCATGTTTTCCCTTTGTTACCTACCGACGGCTGGGCGTATG
ACATTGACAGTCATTAAGTGCAGAAATCTGAAGGCGATGGATATTACTGGCTCATCAGAT
CCTTATGTCAAAGTGTCCCTGATGTGTGAAGGTCGAAGATTAAAAAAGAGGAAAACAACT
ACAAAGAAAAACACTCTAAACCCTGTGTACAATGAGGCCATTATTTTTGACATCCCTCCA
GAGAACGTGGACCAGGTCAGCCTCTCCATTGCGGTCATGGATTACGATAGGGTAGGACAC
AATGAGGTCATAGGAGTGTGCAGAACAGGACTGGATGCTGAGGGTCTTGGGCGAGACCAC
TGGAATGAAATGCTGGCCTATCATCGAAAACCAATAACGCACTGGCACCCATTGCTGGAG
TTACCTGGCCGGGCGACCAGTTTTGATAGTCAAGGATCCTGCCCTTCTCCTAAACCACCT
TCCACACCATAA
Protein Properties
Number of Residues 523
Molecular Weight 59126.3
Theoretical pI 7.7
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 56-76
Protein Sequence
>Synaptotagmin-10
MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVV
VSFCGLALLVVSLFVFWKLCWPCWKSKPVTSNITTLPQSISSAPTEVFETEEKKEIKENE
KPAVKAIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQITEPTSSTRHSSFRRHLPR
QMQVSSVDFSMGTEPVLQRGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQ
YDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETF
QFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTE
SIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDH
WNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCPSPKPPSTP
GenBank ID Protein 37781775
UniProtKB/Swiss-Prot ID Q6XYQ8
UniProtKB/Swiss-Prot Entry Name SYT10_HUMAN
PDB IDs Not Available
GenBank Gene ID AY198413
GeneCard ID SYT10
GenAtlas ID SYT10
HGNC ID HGNC:19266
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zhao E, Li Y, Fu X, Zeng L, Zeng H, Jin W, Chen J, Yin G, Qian J, Ying K, Xie Y, Zhao RC, Mao Y: Cloning and characterization of human synaptotagmin 10 gene. DNA Seq. 2003 Oct;14(5):393-8. [PubMed:14756426 ]