Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08032
Secondary Accession Numbers
  • 13743
Name Synaptotagmin-5
Synonyms
  1. Synaptotagmin V
  2. SytV
Gene Name SYT5
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Regulates the Ca(2+)- dependent secretion of norepinephrine in PC12 cells. Required for export from the endocytic recycling compartment to the cell surface
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
membrane
cell part
organelle
vesicle
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Single-pass membrane protein
  3. Single-pass membrane protein
  4. secretory vesicle
  5. synaptic vesicle membrane
  6. Recycling endosome membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 19q|11p
SNPs SYT5
Gene Sequence
>1161 bp
ATGTTCCCGGAGCCCCCAACCCCGGGGCCTCCATCGCCCGACACGCCTCCCGACTCCAGT
CGCATCAGCCACGGCCCAGTGCCCCCCTGGGCCCTGGCCACCATCGTGCTGGTCTCAGGC
CTCCTCATCTTCAGCTGCTGTTTCTGTCTCTACCGGAAGAGCTGTCGGAGGCGGACAGGC
AAGAAGAGCCAGGCCCAAGCCCAGGTCCACCTTCAGGAAGTGAAGGGGCTGGGCCAGAGT
TACATAGACAAGGTGCAGCCAGAAGTAGAGGAGCTGGAGCCAGCACCATCCGGGCCAGGG
CAGCAGGTGGCAGACAAGCATGAGCTAGGACAACTGCAGTACTCCCTGGATTATGACTTC
CAGAGTGGCCAGCTGCTGGTGGGCATTCTGCAAGCAATGGGATTGGCAGCCTTGGATCTT
GGTGGCTCCTCGGACCCCTATGTGCGGGTCTACCTGCTGCCGGACAAACGGAGGCGGTAC
GAGACCAAGGTGCATCGGCAGACGCTGAACCCTCACTTTGGGGAGACCTTCGCCTTCAAG
GTCCCCTACGTGGAGCTGGGGGGCAGGGTGCTGGTCATGGCGGTGTACGACTTCGACCGC
TTCTCTCGCAATGACGCCATCGGGGAGGTGCGGGTCCCTATGAGCTCCGTGGACCTGGGG
CGGCCAGTGCAGGCCTGGCGGGAGCTGCAGGCGGCTCCGCGGGAGGAGCAGGAGAAGCTT
GGGGACATCTGCTTCTCCCTCCGCTATGTCCCCACGGCCGGGAAGCTCACCGTCATCGTC
CTGGAGGCTAAAAACCTGAAGAAGATGGACGTAGGAGGACTGTCAGATCCATACGTCAAG
GTCCACCTGCTGCAGGGCGGCAAAAAGGTGCGGAAGAAGAAAACCACCATCAAGAAGAAC
ACTCTGAACCCCTATTACAACGAAGCTTTCAGCTTCGAGGTGCCCTGTGACCAAGTCCAG
AAGGTGCAGGTGGAGCTGACCGTGCTGGACTACGACAAGCTGGGCAAGAACGAGGCCATC
GGGAGGGTGGCCGTGGGGGCGGCCGCCGGCGGGGCTGGCCTGCGGCACTGGGCGGACATG
CTGGCCAACCCGCGGCGGCCCATTGCCCAGTGGCACTCGCTGCGGCCCCCGGACCGAGTG
AGGCTGCTGCCTGCGCCCTGA
Protein Properties
Number of Residues 386
Molecular Weight 42900.2
Theoretical pI 9.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 25-45
Protein Sequence
>Synaptotagmin-5
MFPEPPTPGPPSPDTPPDSSRISHGPVPPWALATIVLVSGLLIFSCCFCLYRKSCRRRTG
KKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGRLQYSLDYDF
QSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFK
VPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKL
GDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKN
TLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADM
LANPRRPIAQWHSLRPPDRVRLLPAP
GenBank ID Protein 28279301
UniProtKB/Swiss-Prot ID O00445
UniProtKB/Swiss-Prot Entry Name SYT5_HUMAN
PDB IDs Not Available
GenBank Gene ID BC046157
GeneCard ID SYT5
GenAtlas ID SYT5
HGNC ID HGNC:11513
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Craxton M, Olsen A, Goedert M: Human synaptotagmin V (SYT5): sequence, genomic structure, and chromosomal location. Genomics. 1997 May 15;42(1):165-9. [PubMed:9177789 ]