You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08035
Secondary Accession Numbers
  • 13746
Name Synaptotagmin-9
Synonyms
  1. Synaptotagmin IX
  2. SytIX
Gene Name SYT9
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis
Pathways Not Available
Reactions Not Available
GO Classification
Component
cytoplasmic vesicle
cytoplasmic membrane-bounded vesicle
coated vesicle
clathrin-coated vesicle
synaptic vesicle
membrane
cell part
organelle
vesicle
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Cytoplasmic vesicle
  2. Single-pass membrane protein
  3. secretory vesicle
  4. synaptic vesicle membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11p15.4
SNPs SYT9
Gene Sequence
>1476 bp
ATGCCCGGGGCCAGGGACGCGCTCTGTCACCAGGCGCTGCAGCTGCTGGCCGAGCTCTGT
GCCCGTGGGGCCCTGGAGCACGACAGCTGCCAGGATTTCATTTACCACCTGCGGGACCGT
GCCAGACCCCGGCTCCGCGACCCAGATATCTCAGTGAGCCTGCTGACCCTTGTGGTCACT
GCCTGTGGTCTCGCTCTCTTTGGCGTGTCTCTCTTCGTATCTTGGAAACTCTGCTGGGTT
CCGTGGCGAGAACGAGGCCTGCCCTCTGGTAGCAAAGACAACAACCAGGAGCCCCTTAAC
TACATGGACACAGAGACCAATGAGCAGGAGAACAGTGAGGACTTCCTAGACCCTCCCACG
CCCTGCCCTGACTCCTCCATGAAGATCAGCCACACCTCCCCTGACATTCCCCTCTCCACC
CAGACGGGGATCCAGGAGAACTGTGCCCATGGCGTCCGCGTGCAGCGCCAAGTCACAGAG
CCAACCTCGTCGGCCCGGCATAATTCAATCCGAAGACAACTCAACTTGTCAAACCCGGAC
TTCAATATCCAGCAGCTTCAAAAACAGGAACAGTTGACTGGAATTGGTAGAATTAAACCA
GAGTTATATAAGCAGAGGTCATTGGATAATGATGACGGGAGACGGAGTAACAGCAAGGCT
TGTGGGAAACTGAACTTCATTTTAAAATATGACTGTGACTTAGAGCAGCTCATAGTGAAG
ATTCACAAAGCTGTCAATTTGCCCGCCAAGGACTTTTCTGGGACTTCAGATCCTTATGTC
AAGATCTATTTGCTTCCTGATCGGAAAACAAAACACCAGACTAAAGTTCACAGAAAGACC
CTGAACCCTGTGTTTGATGAAGTGTTTTTATTTCCGGTTCCCTACAATGACCTTGAAGCA
CGGAAGCTTCACTTCTCTGTGTACGACTTTGACAGGTTCTCTCGTCATGACTTAATCGGC
CAAGTGGTGGTGGATCACTTCCTAGACTTGGCTGATTTCCCCAGGGAGTGCATCCTTTGG
AAGGATATCGAATATGTCACCAATGACAACGTGGATCTGGGAGAGCTGATGTTTTCCCTG
TGCTATCTTCCAACGGCTGGCAGGCTGACCATTACCATTATAAAAGCAAGGAATTTAAAG
GCAATGGACATAACAGGAGCATCAGATCCCTATGTGAAAGTCTCGCTGATGTGTGATGGC
AGACGACTGAAGAAGAGGAAAACATCCACCAAGAGGAACACCTTGAATCCTGTTTACAAC
GAAGCCATAGTCTTTGATGTCCCTCCCGAGAACATTGACCAAATCCACTTGTCCATAGCA
GTCATGGACTATGACCGTGTAGGTCACAATGAGATCATCGGCGTGTGTCAAGTAGGCAAC
GAGGCTGAGAGGCTGGGCAGAGACCACTGGAGTGAAATGTTGTCATATCCTCGGAAGCCC
ATTGCACACTGGCATTCCCTGGTGGAGAAACGATGA
Protein Properties
Number of Residues 491
Molecular Weight 56187.5
Theoretical pI 7.23
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 53-73
Protein Sequence
>Synaptotagmin-9
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPT
PCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPD
FNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVK
IHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEA
RKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLVEKR
GenBank ID Protein 28204903
UniProtKB/Swiss-Prot ID Q86SS6
UniProtKB/Swiss-Prot Entry Name SYT9_HUMAN
PDB IDs Not Available
GenBank Gene ID BC046367
GeneCard ID SYT9
GenAtlas ID SYT9
HGNC ID HGNC:19265
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]