You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08043
Secondary Accession Numbers
  • 13754
Name Taste receptor type 2 member 7
Synonyms
  1. T2R7
  2. TRB4
  3. Taste receptor family B member 4
Gene Name TAS2R7
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor activity
Specific Function Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
transmembrane receptor activity
molecular transducer activity
signal transducer activity
g-protein coupled receptor activity
Process
multicellular organismal process
system process
neurological system process
sensory perception
sensory perception of chemical stimulus
sensory perception of taste
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p13
SNPs TAS2R7
Gene Sequence
>957 bp
ATGGCAGATAAAGTGCAGACTACTTTATTGTTCTTAGCAGTTGGAGAGTTTTCAGTGGGG
ATCTTAGGGAATGCATTCATTGGATTGGTAAACTGCATGGACTGGGTCAAGAAGAGGAAA
ATTGCCTCCATTGATTTAATCCTCACAAGTCTGGCCATATCCAGAATTTGTCTATTGTGC
GTAATACTATTAGATTGTTTTATATTGGTGCTATATCCAGATGTCTATGCCACTGGTAAA
GAAATGAGAATCATTGACTTCTTCTGGACACTAACCAATCATTTAAGTATCTGGTTTGCA
ACCTGCCTCAGCATTTACTATTTCTTCAAGATAGGTAATTTCTTTCACCCACTTTTCCTC
TGGATGAAGTGGAGAATTGACAGGGTGATTTCCTGGATTCTACTGGGGTGCGTGGTTCTC
TCTGTGTTTATTAGCCTTCCAGCCACTGAGAATTTGAACGCTGATTTCAGGTTTTGTGTG
AAGGCAAAGAGGAAAACAAACTTAACTTGGAGTTGCAGAGTAAATAAAACTCAACATGCT
TCTACCAAGTTATTTCTCAACCTGGCAACGCTGCTCCCCTTTTGTGTGTGCCTAATGTCC
TTTTTCCTCTTGATCCTCTCCCTGCGGAGACATATCAGGCGAATGCAGCTCAGTGCCACA
GGGTGCAGAGACCCCAGCACAGAAGCCCATGTGAGAGCCCTGAAAGCTGTCATTTCCTTC
CTTCTCCTCTTTATTGCCTACTATTTGTCCTTTCTCATTGCCACCTCCAGCTACTTTATG
CCAGAGACGGAATTAGCTGTGATTTTTGGTGAGTCCATAGCTCTAATCTACCCCTCAAGT
CATTCATTTATCCTAATACTGGGGAACAATAAATTAAGACATGCATCTCTAAAGGTGATT
TGGAAAGTAATGTCTATTCTAAAAGGAAGAAAATTCCAACAACATAAACAAATCTGA
Protein Properties
Number of Residues 318
Molecular Weight 36549.5
Theoretical pI 10.11
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 10-30
  • 56-76
  • 95-115
  • 129-149
  • 188-208
  • 236-256
  • 267-287
Protein Sequence
>Taste receptor type 2 member 7
MADKVQTTLLFLAVGEFSVGILGNAFIGLVNCMDWVKKRKIASIDLILTSLAISRICLLC
VILLDCFILVLYPDVYATGKEMRIIDFFWTLTNHLSIWFATCLSIYYFFKIGNFFHPLFL
WMKWRIDRVISWILLGCVVLSVFISLPATENLNADFRFCVKAKRKTNLTWSCRVNKTQHA
STKLFLNLATLLPFCVCLMSFFLLILSLRRHIRRMQLSATGCRDPSTEAHVRALKAVISF
LLLFIAYYLSFLIATSSYFMPETELAVIFGESIALIYPSSHSFILILGNNKLRHASLKVI
WKVMSILKGRKFQQHKQI
GenBank ID Protein 7262613
UniProtKB/Swiss-Prot ID Q9NYW3
UniProtKB/Swiss-Prot Entry Name TA2R7_HUMAN
PDB IDs Not Available
GenBank Gene ID AF227133
GeneCard ID TAS2R7
GenAtlas ID TAS2R7
HGNC ID HGNC:14913
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Adler E, Hoon MA, Mueller KL, Chandrashekar J, Ryba NJ, Zuker CS: A novel family of mammalian taste receptors. Cell. 2000 Mar 17;100(6):693-702. [PubMed:10761934 ]
  3. Fischer A, Gilad Y, Man O, Paabo S: Evolution of bitter taste receptors in humans and apes. Mol Biol Evol. 2005 Mar;22(3):432-6. Epub 2004 Oct 20. [PubMed:15496549 ]
  4. Chandrashekar J, Mueller KL, Hoon MA, Adler E, Feng L, Guo W, Zuker CS, Ryba NJ: T2Rs function as bitter taste receptors. Cell. 2000 Mar 17;100(6):703-11. [PubMed:10761935 ]
  5. Montmayeur JP, Matsunami H: Receptors for bitter and sweet taste. Curr Opin Neurobiol. 2002 Aug;12(4):366-71. [PubMed:12139982 ]
  6. Margolskee RF: Molecular mechanisms of bitter and sweet taste transduction. J Biol Chem. 2002 Jan 4;277(1):1-4. Epub 2001 Nov 5. [PubMed:11696554 ]
  7. Zhang Y, Hoon MA, Chandrashekar J, Mueller KL, Cook B, Wu D, Zuker CS, Ryba NJ: Coding of sweet, bitter, and umami tastes: different receptor cells sharing similar signaling pathways. Cell. 2003 Feb 7;112(3):293-301. [PubMed:12581520 ]