You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08047
Secondary Accession Numbers
  • 13758
Name Tubulin beta-4 chain
Synonyms
  1. Tubulin 5 beta
Gene Name TUBB4
Protein Type Unknown
Biological Properties
General Function Involved in structural molecule activity
Specific Function Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
microtubule
Function
purine nucleotide binding
binding
nucleotide binding
catalytic activity
hydrolase activity
guanyl nucleotide binding
guanyl ribonucleotide binding
gtp binding
structural molecule activity
gtpase activity
nucleoside-triphosphatase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
Process
cellular process
cellular component organization or biogenesis
cellular component organization
cellular component assembly
macromolecular complex assembly
cellular protein complex assembly
microtubule-based process
microtubule-based movement
protein complex assembly
protein polymerization
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 19p13.3
SNPs TUBB4
Gene Sequence
>1335 bp
ATGCGGGAGATCGTGCACCTGCAGGCCGGCCAGTGCGGCAACCAGATCGGGGCCAAGTTT
TGGGAGGTTATCAGTGACGAACATGGCATCGACCCCACAGGCACATACCATGGGGACAGT
GACCTGCAACTGGAGAGGATCAACGTGTACTACAACGAGGCCACAGGAGGAAATTATGTC
CCCAGAGCGGTGCTGGTGGACCTGGAACCCGGCACCATGGACTCTGTCCGTTCTGGCCCC
TTCGGTCAGATCTTTCGGCCGGACAACTTCGTGTTTGGCCAATCCGGAGCCGGCAACAAC
TGGGCAAAGGGGCACTACACGGAGGGCGCAGAGCTGGTGGACGCTGTCCTGGACGTAGTC
CGGAAGGAGGCCGAGAGCTGCGACTGCCTTCAGGGCTTCCAGCTGACCCACTCGCTGGGG
GGTGGCACGGGGTCCGGAATGGGCACGCTGCTCATCAGTAAGATCCGCGAGGAGTTCCCA
GACCGCATCATGAACACCTTCAGCGTGGTGCCCTCGCCCAAAGTGTCAGACACGGTGGTG
GAGCCCTACAACGCCACGCTGTCTGTGCACCAGCTGGTGGAGAATACGGATGAGACCTAC
TGCATCGACAATGAGGCACTCTACGACATCTGTTTCCGCACCCTCAAGCTGACCACCCCC
ACCTACGGGGACCTCAACCACCTGGTGTCGGCCACCATGAGCGGGGTCACCACCTGCCTG
CGCTTCCCGGGCCAGCTGAACGCCGACCTGCGCAAGCTGGCCGTCAACATGGTTCCCTTT
CCTCGCCTGCACTTCTTCATGCCCGGCTTCGCACCCCTGACCAGCCGGGGCAGCCAGCAG
TACCGGGCCCTGACGGTGCCCGAGCTCACCCAGCAGATGTTCGATGCCAAGAACATGATG
GCGGCGTGCGACCCGCGCCACGGCCGCTACCTGACCGTGGCCGCCGTGTTCCGGGGCCGC
ATGTCCATGAAGGAGGTGGACGAGCAGATGCTGAGCGTGCAGAGCAAGAACAGCAGCTAC
TTCGTGGAGTGGATCCCCAACAACGTGAAGACGGCCGTGTGCGACATCCCGCCCCGCGGC
CTGAAGATGGCCGCGACCTTCATCGGCAACAGCACGGCCATCCAGGAGCTGTTCAAGCGC
ATCTCCGAGCAGTTCACGGCCATGTTCCGGCGCAAGGCCTTCTTGCACTGGTACACGGGC
GAGGGCATGGACGAGATGGAGTTCACCGAGGCCGAGAGCAACATGAATGACCTGGTATCT
GAGTACCAGCAGTACCAGGACGCCACGGCCGAGGAGGGCGAGTTCGAGGAGGAGGCGGAG
GAGGAGGTGGCCTAG
Protein Properties
Number of Residues 444
Molecular Weight 49585.5
Theoretical pI 4.51
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Tubulin beta-4 chain
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P04350
UniProtKB/Swiss-Prot Entry Name TBB4_HUMAN
PDB IDs
GenBank Gene ID AK075307
GeneCard ID TUBB4
GenAtlas ID TUBB4
HGNC ID HGNC:20774
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T: Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries. DNA Res. 2005;12(2):117-26. [PubMed:16303743 ]
  3. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  4. Rogowski K, Juge F, van Dijk J, Wloga D, Strub JM, Levilliers N, Thomas D, Bre MH, Van Dorsselaer A, Gaertig J, Janke C: Evolutionary divergence of enzymatic mechanisms for posttranslational polyglycylation. Cell. 2009 Jun 12;137(6):1076-87. doi: 10.1016/j.cell.2009.05.020. [PubMed:19524510 ]
  5. Lee MG, Loomis C, Cowan NJ: Sequence of an expressed human beta-tubulin gene containing ten Alu family members. Nucleic Acids Res. 1984 Jul 25;12(14):5823-36. [PubMed:6462917 ]
  6. Baumann MH, Wisniewski T, Levy E, Plant GT, Ghiso J: C-terminal fragments of alpha- and beta-tubulin form amyloid fibrils in vitro and associate with amyloid deposits of familial cerebral amyloid angiopathy, British type. Biochem Biophys Res Commun. 1996 Feb 6;219(1):238-42. [PubMed:8619814 ]