Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08068
Secondary Accession Numbers
  • 13779
Name Two pore calcium channel protein 1
Synonyms
  1. Voltage-dependent calcium channel protein TPC1
Gene Name TPCN1
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function May function as one of the major voltage-gated Ca(2+) channel (VDCC) across the plasma membrane
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 12q24.13
SNPs TPCN1
Gene Sequence
>2451 bp
ATGGCTGTGAGTTTGGATGACGACGTGCCGCTCATCCTGACCTTGGATGAGGGTGGCAGT
GCCCCACTGGCTCCCTCCAACGGCCTGGGCCAAGAAGAGCTACCTAGCAAAAATGGCGGC
AGCTATGCCATCCACGACTCCCAGGCCCCCAGTCTCAGCTCTGGGGGTGAGAGTTCCCCC
TCCAGCCCCGCACACAACTGGGAGATGAATTACCAAGAGGCAGCAATCTACCTCCAGGAA
GGCGAGAACAACGACAAGTTCTTCACCCACCCCAAGGATGCCAAGGCGCTGGCGGCCTAC
CTCTTTGCACACAATCACCTCTTCTACCTGATGGAGCTGGCCACGGCCCTGCTGCTGCTG
CTGCTCTCCCTGTGCGAGGCCCCCGCCGTCCCCGCACTCCGGCTTGGCATCTATGTCCAC
GCCACCCTGGAGCTGTTTGCCCTGATGGTGGTAGTGTTTGAACTCTGCATGAAGTTACGC
TGGCTGGGCCTCCACACCTTCATCCGGCACAAGCGGACCATGGTCAAGACCTCGGTGCTG
GTGGTGCAGTTTGTCGAGGCCATCGTGGTGTTGGTACGGCAGATGTCCCATGTGCGGGTG
ACCCGAGCACTGCGCTGCATTTTCCTGGTGGACTGTCGGTATTGCGGTGGCGTCCGGCGC
AACCTGCGGCAGATCTTCCAGTCCCTGCCGCCCTTCATGGACATCCTCCTGCTGCTGCTG
TTCTTCATGATCATCTTTGCCATCCTCGGTTTCTACTTGTTCTCCCCTAACCCTTCAGAC
CCCTACTTCAGCACCCTGGAGAACAGCATCGTCAGTCTGTTTGTCCTTCTGACCACAGCC
AATTTCCCAGATGTGATGATGCCCTCCTACTCCCGGAACCCCTGGTCCTGCGTCTTCTTC
ATCGTGTACCTCTCCATCGAGCTGTATTTCATCATGAACCTGCTTCTGGCTGTGGTGTTC
GACACCTTCAATGACATTGAGAAACGCAAGTTCAAGTCTTTGCTACTGCACAAGCGAACC
GCTATCCAGCATGCCTACCGCCTGCTCATCAGCCAGAGGAGGCCTGCCGGCATCTCCTAC
AGGCAGTTTGAAGGCCTCATGCGCTTCTACAAGCCCCGGATGAGTGCCAGGGAGCGCTAT
CTTACCTTCAAGGCCCTGAATCAGAACAACACACCCCTGCTCAGCCTAAAGGACTTTTAC
GATATCTACGAAGTTGCTGCTTTGAAGTGGAAGGCCAAGAAAAACAGAGAGCACTGGTTT
GATGAGCTTCCCAGGACGGCGCTCCTCATCTTCAAAGGTATTAATATCCTTGTGAAGTCC
AAGGCCTTCCAGTATTTCATGTACTTGGTGGTGGCAGTCAACGGGGTCTGGATCCTCGTG
GAGACATTTATGCTGAAAGGTGGGAACTTCTTCTCCAAGCACGTGCCCTGGAGTTACCTC
GTCTTTCTAACTATCTATGGGGTGGAGCTGTTCCTGAAGGTTGCCGGCCTGGGCCCTGTG
GAGTACTTGTCTTCCGGATGGAACTTGTTTGACTTCTCCGTGACAGTGTTCGCCTTCCTG
GGACTGCTGGCGCTGGCCCTCAACATGGAGCCCTTCTATTTCATCGTGGTCCTGCGCCCC
CTCCAGCTGCTGAGGTTGTTTAAGTTGAAGGAGCGCTACCGCAACGTGCTGGACACCATG
TTCGAGCTGCTGCCCCGGATGGCCAGCCTGGGCCTCACCCTGCTCATCTTTTACTACTCC
TTCGCCATCGTGGGCATGGAGTTCTTCTGCGGGATCGTCTTCCCCAACTGCTGCAACACG
AGTACAGTGGCAGATGCCTACCGCTGGCGCAACCACACCGTGGGCAACAGGACCGTGGTG
GAGGAAGGCTACTATTATCTCAATAATTTTGACAACATCCTCAACAGCTTTGTGACCCTG
TTTGAGCTCACAGTTGTCAACAACTGGTACATCATCATGGAAGGCGTCACCTCTCAGACC
TCCCACTGGAGCCGCCTCTACTTCATGACCTTTTACATTGTGACCATGGTGGTGATGACG
ATCATTGTCGCCTTTATCCTCGAGGCCTTCGTCTTCCGAATGAACTACAGCCGCAAGAAC
CAGGACTCGGAAGTTGATGGTGGCATCACCCTTGAGAAGGAAATCTCCAAAGAAGAGCTG
GTTGCCGTCCTGGAGCTCTACCGGGAGGCACGGGGGGCCTCCTCGGATGTCACCAGGCTG
CTGGAGACCCTCTCCCAGATGGAGAGATACCAGCAACATTCCATGGTGTTTCTGGGACGG
CGATCAAGGACCAAGAGCGACCTGAGCCTGAAGATGTACCAGGAGGAGATCCAGGAGTGG
TATGAGGAGCATGCCAGGGAGCAAGAGCAGCAGCGACAACTCAGCAGCAGTGCAGCCCCC
GCCGCCCAGCAGCCCCCAGGCAGCCGCCAGCGCTCCCAGACCGTTACCTAG
Protein Properties
Number of Residues 816
Molecular Weight 94145.9
Theoretical pI 8.39
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 113-133
  • 135-155
  • 178-198
  • 235-255
  • 270-290
  • 298-318
  • 445-465
  • 480-500
  • 504-526
  • 574-594
  • 633-653
  • 671-691
Protein Sequence
>Two pore calcium channel protein 1
MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSP
SSPAHNWEMNYQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
LLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVL
VVQFVEAIVVLVRQMSHVRVTRALRCIFLVDCRYCGGVRRNLRQIFQSLPPFMDILLLLL
FFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTANFPDVMMPSYSRNPWSCVFF
IVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLISQRRPAGISY
RQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYL
VFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRP
LQLLRLFKLKERYRNVLDTMFELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNT
STVADAYRWRNHTVGNRTVVEEGYYYLNNFDNILNSFVTLFELTVVNNWYIIMEGVTSQT
SHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKNQDSEVDGGITLEKEISKEEL
VAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSLKMYQEEIQEW
YEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT
GenBank ID Protein 29725622
UniProtKB/Swiss-Prot ID Q9ULQ1
UniProtKB/Swiss-Prot Entry Name TPC1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017901.4
GeneCard ID TPCN1
GenAtlas ID TPCN1
HGNC ID HGNC:18182
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  4. Hirosawa M, Nagase T, Ishikawa K, Kikuno R, Nomura N, Ohara O: Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain. DNA Res. 1999 Oct 29;6(5):329-36. [PubMed:10574461 ]