Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08069
Secondary Accession Numbers
  • 13780
Name Two pore calcium channel protein 2
Synonyms
  1. Voltage-dependent calcium channel protein TPC2
Gene Name TPCN2
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function May function as one of the major voltage-gated Ca(2+) channel (VDCC) across the plasma membrane
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.3
SNPs TPCN2
Gene Sequence
>2259 bp
ATGGCGGAACCCCAGGCGGAGTCGGAGCCCCTGCTGGGCGGGGCCCGCGGCGGTGGCGGC
GACTGGCCGGCGGGGCTGACCACTTACCGCAGCATCCAAGTCGGCCCTGGTGCCGCGGCC
AGGTGGGACCTCTGCATTGATCAGGCTGTGGTCTTCATCGAAGATGCTATTCAGTACCGC
TCCATCAACCACCGGGTGGATGCCAGCTCGATGTGGCTTTACCGACGGTATTACTCGAAC
GTATGCCAACGGACTTTGAGCTTCACCATCTTCTTGATCCTGTTTTTGGCTTTTATCGAG
ACCCCATCCTCACTCACCAGCACGGCGGACGTGCGCTACCGCGCTGCCCCCTGGGAGCCG
CCCTGCGGCCTGACCGAGAGTGTCGAGGTGCTCTGCCTGCTGGTCTTTGCGGCCGACCTC
TCTGTGAAGGGTTACCTGTTCGGGTGGGCCCATTTCCAGAAAAACCTTTGGCTGCTGGGC
TACCTCGTGGTGCTGGTGGTGTCTCTGGTGGACTGGACCGTGTCCCTGAGTCTCGTGTGT
CATGAGCCCCTGCGGATCCGCCGGCTTCTCCGTCCCTTCTTCCTGCTGCAGAACTCCTCT
ATGATGAAGAAGACCTTGAAATGCATCCGCTGGTCGCTGCCGGAAATGGCCAGCGTCGGG
CTGCTGCTGGCCATCCACCTGTGCCTCTTCACCATGTTCGGAATGCTGCTGTTCGCTGGT
GGGAAGCAGGATGATGGGCAGGACAGGGAGAGGCTGACCTACTTCCAGAACCTGCCTGAG
TCTCTGACTTCCCTCCTGGTGCTGCTGACCACGGCCAACAACCCCGATGTGATGATTCCT
GCGTATTCCAAGAACCGGGCCTATGCCATCTTCTTCATAGTCTTCACTGTGATAGGAAGC
CTGTTTCTGATGAACCTGCTGACAGCCATCATCTACAGTCAGTTCCGGGGCTACCTGATG
AAATCTCTCCAGACCTCGCTGTTTCGGAGGCGGCTGGGAACCCGGGCTGCCTTTGAAGTC
CTATCCTCCATGGTGGGGGAGGGAGGAGCCTTCCCTCAGGCAGTTGGGGTGAAGCCCCAG
AACTTGCTGCAGGTGCTTCAGAAGGTCCAGCTGGACAGCTCCCACAAACAGGCCATGATG
GAGAAGGTGCGTTCCTATGGCAGTGTTCTGCTCTCAGCTGAGGAGTTTCAGAAGCTCTTC
AACGAGCTTGACAGAAGTGTGGTTAAAGAGCACCCGCCGAGGCCCGAGTACCAGTCTCCG
TTTCTGCAGAGCGCCCAGTTCCTCTTCGGCCACTACTACTTTGACTACCTGGGGAACCTC
ATCGCCCTGGCAAACCTGGTGTCCATTTGCGTGTTCCTGGTGCTGGATGCAGATGTGCTG
CCTGCTGAGCGTGATGACTTCATCCTGGGGATTCTCAACTGCGTCTTCATTGTGTACTAC
CTGTTGGAGATGCTGCTCAAGGTCTTTGCCCTGGGCCTGCGAGGGTACCTGTCCTACCCC
AGCAACGTGTTTGACGGGCTCCTCACCGTTGTCCTGCTGGTTTTGGAGATCTCAACTCTG
GCTGTGTACCGATTGCCACACCCAGGCTGGAGGCCGGAGATGGTGGGCCTGCTGTCGCTG
TGGGACATGACCCGCATGCTGAACATGCTCATCGTGTTCCGCTTCCTGCGTATCATCCCC
AGCATGAAGCTGATGGCCGTGGTGGCCAGTACCGTCCTGGGCCTGGTGCAGAACATGCGT
GCGTTTGGCGGGATCCTGGTGGTGGTCTACTACGTATTTGCCATCATTGGGATCAACTTG
TTTAGAGGCGTCATTGTGGCTCTTCCTGGAAACAGCAGCCTGGCCCCTGCCAATGGCTCG
GCGCCCTGTGGGAGCTTCGAGCAGCTGGAGTACTGGGCCAACAACTTCGATGACTTTGCG
GCTGCCCTGGTCACTCTGTGGAACTTGATGGTGGTGAACAACTGGCAGGTGTTTCTGGAT
GCATATCGGCGCTACTCAGGCCCGTGGTCCAAGATCTATTTTGTATTGTGGTGGCTGGTG
TCGTCTGTCATCTGGGTCAACCTGTTTCTGGCCCTGATTCTGGAGAACTTCCTTCACAAG
TGGGACCCCCGCAGCCACCTGCAGCCCCTTGCTGGGACCCCAGAGGCCACCTACCAGATG
ACTGTGGAGCTCCTGTTCAGGGATATTCTGGAGGAGCCCGGGGAGGATGAGCTCACAGAG
AGGCTGAGCCAGCACCCGCACCTGTGGCTGTGCAGGTGA
Protein Properties
Number of Residues 752
Molecular Weight 85242.1
Theoretical pI 7.1
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 85-105
  • 156-176
  • 219-239
  • 290-310
  • 337-357
  • 440-460
  • 466-486
  • 503-523
  • 555-575
  • 581-601
  • 639-659
  • 674-694
Protein Sequence
>Two pore calcium channel protein 2
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSL
WDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR
GenBank ID Protein 157502181
UniProtKB/Swiss-Prot ID Q8NHX9
UniProtKB/Swiss-Prot Entry Name TPC2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_139075.3
GeneCard ID TPCN2
GenAtlas ID TPCN2
HGNC ID HGNC:20820
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Sulem P, Gudbjartsson DF, Stacey SN, Helgason A, Rafnar T, Jakobsdottir M, Steinberg S, Gudjonsson SA, Palsson A, Thorleifsson G, Palsson S, Sigurgeirsson B, Thorisdottir K, Ragnarsson R, Benediktsdottir KR, Aben KK, Vermeulen SH, Goldstein AM, Tucker MA, Kiemeney LA, Olafsson JH, Gulcher J, Kong A, Thorsteinsdottir U, Stefansson K: Two newly identified genetic determinants of pigmentation in Europeans. Nat Genet. 2008 Jul;40(7):835-7. doi: 10.1038/ng.160. Epub 2008 May 18. [PubMed:18488028 ]