Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08076
Secondary Accession Numbers
  • 13787
Name Short transient receptor potential channel 4
Synonyms
  1. Trp-related protein 4
  2. TrpC4
  3. hTrp-4
  4. hTrp4
Gene Name TRPC4
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Form a receptor-activated non-selective calcium permeant cation channel. Acts as a cell-cell contact-dependent endothelial calcium entry channel. Probably operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Mediates cation entry, with an enhanced permeability to barium over calcium. May also be activated by intracellular calcium store depletion
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
calcium channel activity
Process
di-, tri-valent inorganic cation transport
divalent metal ion transport
calcium ion transport
establishment of localization
transport
transmembrane transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Membrane
  3. Multi-pass membrane protein
  4. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 13q13.3
SNPs TRPC4
Gene Sequence
>2934 bp
ATGGCTCAGTTCTATTACAAAAGAAATGTTAATGCTCCCTATAGAGACCGCATCCCTCTA
AGGATAGTAAGAGCAGAATCAGAACTTTCGCCATCAGAAAAAGCCTACTTGAATGCTGTG
GAAAAGGGAGATTATGCCAGTGTCAAGAAATCCCTAGAGGAAGCTGAAATTTATTTTAAA
ATCAATATTAATTGCATTGATCCTCTCGGAAGAACTGCTCTCCTCATTGCAATTGAAAAT
GAGAACTTGGAGCTCATCGAACTACTCTTAAGCTTTAATGTCTATGTTGGAGATGCTCTA
TTACATGCTATCAGAAAAGAAGTCGTCGGAGCTGTTGAGCTGTTATTGAACCACAAAAAA
CCTAGTGGAGAAAAACAGGTGCCTCCTATACTCCTTGATAAGCAGTTCTCTGAATTCACT
CCAGACATTACACCAATCATTTTGGCAGCCCATACAAATAATTATGAGATAATAAAACTC
TTGGTTCAGAAAGGAGTCTCAGTGCCTCGACCCCACGAGGTCCGCTGTAACTGTGTGGAA
TGCGTGTCCAGTTCAGATGTGGACAGCCTCCGTCACTCACGCTCCAGACTCAACATCTAC
AAGGCCTTGGCCAGTCCCTCTCTCATTGCACTGTCAAGCGAAGATCCTTTTCTCACAGCC
TTTCAGTTAAGTTGGGAACTTCAGGAACTGAGCAAGGTGGAAAATGAATTCAAGTCGGAG
TATGAAGAGCTGTCACGGCAGTGCAAACAATTTGCTAAGGACCTACTGGATCAGACGAGA
AGTTCCAGAGAACTGGAAATCATTCTTAATTACCGAGATGACAATAGTCTCATAGAAGAA
CAAAGTGGAAATGATCTTGCAAGACTAAAATTGGCCATTAAGTACCGTCAAAAAGAGTTT
GTTGCCCAGCCCAATTGTCAACAGCTGCTGGCATCTCGCTGGTACGATGAGTTTCCAGGC
TGGAGGAGAAGACACTGGGCAGTGAAGATGGTGACATGTTTCATAATAGGACTTCTTTTT
CCTGTCTTCTCTGTGTGCTACCTGATAGCTCCCAAAAGCCCACTTGGACTGTTCATCAGG
AAGCCATTTATCAAGTTTATCTGCCACACAGCCTCCTATTTGACTTTTTTGTTCCTGCTG
CTGCTTGCCTCTCAGCACATCGACAGGTCAGACTTGAACAGGCAAGGTCCACCACCAACC
ATCGTCGAGTGGATGATATTACCGTGGGTCCTGGGCTTCATATGGGGAGAAATTAAACAG
ATGTGGGATGGCGGACTTCAGGACTACATCCATGATTGGTGGAATCTAATGGACTTTGTA
ATGAACTCCTTATATTTAGCAACAATCTCCTTGAAAATTGTTGCATTTGTAAAGTACAGT
GCCCTTAATCCACGAGAATCATGGGACATGTGGCATCCCACTCTGGTGGCAGAAGCTTTA
TTTGCTATTGCAAACATCTTCAGTTCTCTGCGTCTGATCTCACTGTTTACTGCAAATTCT
CACCTGGGACCTCTGCAAATATCTCTGGGAAGAATGCTCCTGGACATTTTGAAGTTTCTA
TTCATATACTGCCTTGTGTTGCTAGCATTTGCAAATGGCCTAAATCAATTGTACTTCTAT
TATGAAGAAACGAAAGGGTTAACCTGCAAAGGCATAAGATGTGAAAAGCAGAATAATGCA
TTTTCAACGTTATTTGAGACACTGCAGTCCCTGTTTTGGTCAATATTTGGGCTCATCAAT
TTATATGTGACCAATGTCAAAGCACAGCATGAATTTACTGAGTTTGTTGGTGCCACCATG
TTTGGGACATACAATGTCATCTCTCTGGTTGTTCTACTCAACATGTTAATAGCTATGATG
AATAATTCTTACCAACTGATTGCTGACCATGCAGATATAGAATGGAAATTTGCACGAACA
AAGCTTTGGATGAGTTATTTTGAAGAAGGAGGTACTCTGCCTACTCCCTTCAATGTCATC
CCGAGCCCCAAGTCTCTCTGGTACCTGATCAAATGGATCTGGACACACTTGTGCAAGAAA
AAGATGAGAAGAAAGCCAGAAAGTTTTGGAACAATAGGGAGGCGAGCTGCTGATAACTTG
AGAAGACATCACCAATACCAAGAAGTTATGAGGAACCTGGTGAAGCGATACGTTGCTGCA
ATGATTAGAGATGCTAAAACTGAAGAAGGCCTGACCGAAGAGAACTTTAAGGAACTAAAG
CAAGACATTTCTAGTTTCCGCTTTGAAGTCCTGGGATTACTAAGAGGAAGCAAACTTTCC
ACAATACAATCTGCGAATGCCTCGAAGGAGTCTTCAAATTCGGCAGACTCAGATGAAAAG
AGTGATAGCGAAGGTAATAGCAAGGACAAGAAAAAGAATTTCAGCCTTTTTGATTTAACC
ACCCTGATTCATCCGAGATCAGCAGCAATTGCCTCTGAAAGACATAACATAAGCAATGGC
TCTGCCCTGGTGGTTCAGGAGCCGCCCAGGGAGAAGCAGAGAAAAGTGAATTTTGTGACC
GATATCAAAAACTTTGGGTTATTTCATAGACGATCAAAACAAAATGCTGCTGAGCAAAAT
GCAAACCAAATCTTCTCTGTTTCAGAAGAAGTTGCTCGTCAACAGGCTGCAGGACCACTT
GAGAGAAATATTCAACTGGAATCTCGAGGATTAGCTTCACGGGGTGACCTGAGCATTCCC
GGTCTCAGTGAACAATGTGTGTTAGTAGACCATAGAGAAAGGAATACGGACACACTGGGG
TTACAGGTAGGAAAGAGAGTGTGTCCATTCAAGTCAGAGAAGGTGGTGGTGGAGGACACG
GTTCCTATAATACCAAAGGAGAAACATGCAAAAGAAGAGGACTCTAGTATAGACTATGAT
CTAAACCTCCCAGACACAGTCACCCACGAAGATTACGTGACCACAAGATTGTGA
Protein Properties
Number of Residues 977
Molecular Weight 112099.9
Theoretical pI 7.83
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 330-350
  • 363-383
  • 437-457
  • 470-490
  • 512-532
  • 600-620
Protein Sequence
>Short transient receptor potential channel 4
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKESSNSADSDEK
SDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIP
GLSEQCVLVDHRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYD
LNLPDTVTHEDYVTTRL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UBN4
UniProtKB/Swiss-Prot Entry Name TRPC4_HUMAN
PDB IDs Not Available
GenBank Gene ID AF063822
GeneCard ID TRPC4
GenAtlas ID TRPC4
HGNC ID HGNC:12336
References
General References
  1. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  4. Mery L, Strauss B, Dufour JF, Krause KH, Hoth M: The PDZ-interacting domain of TRPC4 controls its localization and surface expression in HEK293 cells. J Cell Sci. 2002 Sep 1;115(Pt 17):3497-508. [PubMed:12154080 ]
  5. Miehe S, Bieberstein A, Arnould I, Ihdene O, Rutten H, Strubing C: The phospholipid-binding protein SESTD1 is a novel regulator of the transient receptor potential channels TRPC4 and TRPC5. J Biol Chem. 2010 Apr 16;285(16):12426-34. doi: 10.1074/jbc.M109.068304. Epub 2010 Feb 17. [PubMed:20164195 ]
  6. Graziani A, Poteser M, Heupel WM, Schleifer H, Krenn M, Drenckhahn D, Romanin C, Baumgartner W, Groschner K: Cell-cell contact formation governs Ca2+ signaling by TRPC4 in the vascular endothelium: evidence for a regulatory TRPC4-beta-catenin interaction. J Biol Chem. 2010 Feb 5;285(6):4213-23. doi: 10.1074/jbc.M109.060301. Epub 2009 Dec 8. [PubMed:19996314 ]
  7. Zhu X, Jiang M, Peyton M, Boulay G, Hurst R, Stefani E, Birnbaumer L: trp, a novel mammalian gene family essential for agonist-activated capacitative Ca2+ entry. Cell. 1996 May 31;85(5):661-71. [PubMed:8646775 ]
  8. Lussier MP, Cayouette S, Lepage PK, Bernier CL, Francoeur N, St-Hilaire M, Pinard M, Boulay G: MxA, a member of the dynamin superfamily, interacts with the ankyrin-like repeat domain of TRPC. J Biol Chem. 2005 May 13;280(19):19393-400. Epub 2005 Mar 9. [PubMed:15757897 ]
  9. Lussier MP, Lepage PK, Bousquet SM, Boulay G: RNF24, a new TRPC interacting protein, causes the intracellular retention of TRPC. Cell Calcium. 2008 May;43(5):432-43. Epub 2007 Sep 11. [PubMed:17850865 ]
  10. Odell AF, Van Helden DF, Scott JL: The spectrin cytoskeleton influences the surface expression and activation of human transient receptor potential channel 4 channels. J Biol Chem. 2008 Feb 15;283(7):4395-407. Epub 2007 Nov 29. [PubMed:18048348 ]
  11. Hofmann T, Schaefer M, Schultz G, Gudermann T: Subunit composition of mammalian transient receptor potential channels in living cells. Proc Natl Acad Sci U S A. 2002 May 28;99(11):7461-6. [PubMed:12032305 ]
  12. McKay RR, Szymeczek-Seay CL, Lievremont JP, Bird GS, Zitt C, Jungling E, Luckhoff A, Putney JW Jr: Cloning and expression of the human transient receptor potential 4 (TRP4) gene: localization and functional expression of human TRP4 and TRP3. Biochem J. 2000 Nov 1;351 Pt 3:735-46. [PubMed:11042129 ]
  13. Mery L, Magnino F, Schmidt K, Krause KH, Dufour JF: Alternative splice variants of hTrp4 differentially interact with the C-terminal portion of the inositol 1,4,5-trisphosphate receptors. FEBS Lett. 2001 Jan 5;487(3):377-83. [PubMed:11163362 ]
  14. Schaefer M, Plant TD, Stresow N, Albrecht N, Schultz G: Functional differences between TRPC4 splice variants. J Biol Chem. 2002 Feb 1;277(5):3752-9. Epub 2001 Nov 16. [PubMed:11713258 ]
  15. Cioffi DL, Wu S, Alexeyev M, Goodman SR, Zhu MX, Stevens T: Activation of the endothelial store-operated ISOC Ca2+ channel requires interaction of protein 4.1 with TRPC4. Circ Res. 2005 Nov 25;97(11):1164-72. Epub 2005 Oct 27. [PubMed:16254212 ]
  16. Odell AF, Scott JL, Van Helden DF: Epidermal growth factor induces tyrosine phosphorylation, membrane insertion, and activation of transient receptor potential channel 4. J Biol Chem. 2005 Nov 11;280(45):37974-87. Epub 2005 Sep 6. [PubMed:16144838 ]