Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08085
Secondary Accession Numbers
  • 13796
Name Transient receptor potential cation channel subfamily V member 5
Synonyms
  1. CaT2
  2. Calcium transport protein 2
  3. ECaC
  4. ECaC1
  5. Epithelial calcium channel 1
  6. OTRPC3
  7. Osm-9-like TRP channel 3
  8. TrpV5
Gene Name TRPV5
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)- dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Multi-pass membrane protein
  2. Apical cell membrane
Gene Properties
Chromosome Location Chromosome:7
Locus 7q35
SNPs TRPV5
Gene Sequence
>2190 bp
ATGGGGGGTTTTCTACCTAAGGCAGAAGGGCCCGGGAGCCAACTCCAGAAACTTCTGCCC
TCCTTTCTGGTCAGAGAACAAGACTGGGACCAGCACCTGGACAAGCTTCATATGCTGCAG
CAGAAGAGGATTCTAGAGTCTCCACTGCTTCGAGCATCCAAGGAAAATGACCTGTCTGTT
CTTAGGCAACTTCTACTGGACTGCACCTGTGACGTTCGACAAAGAGGAGCCCTGGGGGAG
ACGGCGCTGCACATAGCAGCCCTCTATGACAACTTGGAGGCGGCCTTGGTGCTGATGGAG
GCTGCCCCAGAGCTGGTCTTTGAGCCCACCACATGTGAGGCTTTTGCAGGTCAGACTGCA
CTGCACATCGCTGTTGTGAACCAGAATGTGAACCTGGTGCGTGCCCTGCTCACCCGCAGG
GCCAGTGTCTCTGCCAGAGCCACAGGCACTGCCTTCCGCCGTAGTCCCCGCAACCTCATC
TACTTTGGGGAGCACCCTTTGTCCTTTGCTGCCTGTGTGAACAGCGAGGAGATCGTGCGG
CTGCTCATTGAGCATGGAGCTGACATCAGGGCCCAGGACTCCCTGGGAAACACAGTATTA
CACATCCTCATCCTCCAGCCCAACAAAACCTTTGCCTGCCAGATGTACAACCTGCTGCTG
TCCTACGATGGACATGGGGACCACCTGCAGCCCCTGGACCTTGTGCCCAATCACCAGGGT
CTCACCCCCTTCAAGCTGGCTGGAGTGGAGGGTAACACTGTGATGTTCCAGCACCTGATG
CAGAAGCGGAGGCACATCCAGTGGACGTATGGACCCCTGACCTCCATTCTCTACGACCTC
ACAGAGATCGACTCCTGGGGAGAGGAGCTGTCCTTCCTGGAGCTTGTGGTCTCCTCTGAT
AAACGAGAGGCTCGCCAAATTCTGGAACAGACCCCAGTGAAGGAGCTGGTGAGCTTCAAG
TGGAACAAGTATGGCCGGCCGTACTTCTGCATCCTGGCTGCCTTGTACCTGCTCTACATG
ATCTGCTTTACCACGTGCTGCGTCTACCGCCCCCTTAAGTTTCGTGGTGGCAACCGCACT
CATTCTCGAGACATCACCATCCTCCAGCAAAAACTACTACAGGAGGCCTATGAGACACGT
GAAGATATCATCAGGCTGGTGGGGGAGCTGGTGAGCATCGTTGGGGCTGTGATCATCCTG
CTCCTAGAGATTCCAGACATCTTCAGGGTTGGTGCCTCTCGCTATTTTGGAAAGACGATT
CTTGGGGGGCCATTCCATGTCATCATCATCACCTATGCCTCCCTGGTGCTGGTGACCATG
GTGATGCGGCTCACCAACACCAATGGGGAGGTGGTGCCCATGTCCTTTGCCCTGGTGCTG
GGCTGGTGCAGTGTCATGTATTTCACTCGAGGATTCCAGATGCTGGGTCCCTTCACCATC
ATGATCCAGAAGATGATTTTTGGAGACCTAATGCGTTTCTGCTGGCTGATGGCTGTGGTC
ATCTTGGGATTTGCCTCCGCGTTCTATATCATTTTCCAGACAGAGGACCCAACCAGTCTG
GGGCAATTCTATGACTACCCCATGGCACTGTTCACCACCTTTGAGCTTTTTCTCACTGTT
ATTGATGCACCTGCCAACTACGACGTGGACTTGCCCTTCATGTTCAGCATTGTCAACTTC
GCCTTCGCCATCATTGCCACACTGCTCATGCTCAACTTGTTCATCGCCATGATGGGCGAC
ACCCACTGGAGGGTGGCCCAGGAGAGGGATGAGCTCTGGAGGGCCCAGGTCGTGGCCACC
ACAGTGATGCTGGAGCGGAAGCTGCCTCGCTGCCTGTGGCCTCGCTCCGGGATCTGTGGG
TGCGAATTCGGGCTGGGGGACCGCTGGTTCCTGCGGGTTGAGAACCACAATGATCAGAAT
CCTCTGCGAGTGCTTCGCTATGTGGAAGTGTTCAAGAACTCAGACAAGGAGGATGACCAG
GAGCATCCATCTGAGAAACAGCCCTCTGGGGCTGAGAGTGGGACTCTAGCCAGAGCCTCT
TTGGCTCTTCCAACTTCCTCCCTGTCCCGGACCGCGTCCCAGAGCAGCAGTCACCGAGGC
TGGGAGATCCTTCGTCAAAACACCCTGGGGCACTTGAATCTTGGACTGAACCTTAGTGAG
GGGGATGGAGAGGAGGTCTACCATTTTTGA
Protein Properties
Number of Residues 729
Molecular Weight 82549.9
Theoretical pI 6.43
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 329-349
  • 388-408
  • 420-440
  • 449-469
  • 493-513
  • 557-577
Protein Sequence
>Transient receptor potential cation channel subfamily V member 5
MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSV
LRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTA
LHIAVVNQNVNLVRALLTRRASVSARATGTAFRRSPRNLIYFGEHPLSFAACVNSEEIVR
LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLDLVPNHQG
LTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDSWGEELSFLELVVSSD
KREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRT
HSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI
LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTI
MIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTV
IDAPANYDVDLPFMFSIVNFAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVAT
TVMLERKLPRCLWPRSGICGCEFGLGDRWFLRVENHNDQNPLRVLRYVEVFKNSDKEDDQ
EHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRGWEILRQNTLGHLNLGLNLSE
GDGEEVYHF
GenBank ID Protein 17383973
UniProtKB/Swiss-Prot ID Q9NQA5
UniProtKB/Swiss-Prot Entry Name TRPV5_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ271207
GeneCard ID TRPV5
GenAtlas ID TRPV5
HGNC ID HGNC:3145
References
General References
  1. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  2. Peng JB, Brown EM, Hediger MA: Structural conservation of the genes encoding CaT1, CaT2, and related cation channels. Genomics. 2001 Aug;76(1-3):99-109. [PubMed:11549322 ]
  3. Muller D, Hoenderop JG, Meij IC, van den Heuvel LP, Knoers NV, den Hollander AI, Eggert P, Garcia-Nieto V, Claverie-Martin F, Bindels RJ: Molecular cloning, tissue distribution, and chromosomal mapping of the human epithelial Ca2+ channel (ECAC1). Genomics. 2000 Jul 1;67(1):48-53. [PubMed:10945469 ]