Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08087
Secondary Accession Numbers
  • 13798
Name Trypsin-2
Synonyms
  1. Anionic trypsinogen
  2. Serine protease 2
  3. Trypsin II
Gene Name PRSS2
Protein Type Unknown
Biological Properties
General Function Involved in serine-type endopeptidase activity
Specific Function Preferential cleavage:Arg-|-Xaa, Lys-|-Xaa
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
serine-type endopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
  2. extracellular space
Gene Properties
Chromosome Location Chromosome:7
Locus 7q34
SNPs PRSS2
Gene Sequence
>744 bp
ATGAATCTACTCCTGATCCTTACCTTTGTTGCAGCTGCTGTTGCTGCCCCCTTTGATGAT
GATGACAAGATCGTTGGGGGCTACATCTGTGAGGAGAATTCTGTCCCCTACCAGGTGTCC
TTGAATTCTGGCTACCACTTCTGCGGTGGCTCCCTCATCAGCGAACAGTGGGTGGTGTCA
GCAGGTCACTGCTACAAGTCCCGCATCCAGGTGAGACTGGGAGAGCACAACATCGAAGTC
CTGGAGGGGAATGAACAGTTCATCAATGCGGCCAAGATCATCCGCCACCCCAAATACAAC
AGCCGGACTCTGGACAATGACATCCTGCTGATCAAGCTCTCCTCACCTGCCGTCATCAAT
TCCCGCGTGTCCGCCATCTCTCTGCCCACTGCCCCTCCAGCTGCTGGCACCGAGTCCCTC
ATCTCCGGCTGGGGCAACACTCTGAGTTCTGGTGCCGACTACCCAGACGAGCTGCAGTGC
CTGGATGCTCCTGTGCTGAGCCAGGCTGAGTGTGAAGCCTCCTACCCTGGAAAGATTACC
AACAACATGTTCTGTGTGGGCTTCCTCGAGGGAGGCAAGGATTCCTGCCAGGGTGATTCT
GGTGGCCCTGTGGTCTCCAATGGAGAGCTCCAAGGAATTGTCTCCTGGGGCTATGGCTGT
GCCCAGAAGAACAGGCCTGGAGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAG
GACACCATAGCTGCCAACAGCTAA
Protein Properties
Number of Residues 247
Molecular Weight 26487.6
Theoretical pI 4.54
Pfam Domain Function
Signals
  • 1-15
Transmembrane Regions
  • None
Protein Sequence
>Trypsin-2
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P07478
UniProtKB/Swiss-Prot Entry Name TRY2_HUMAN
PDB IDs
GenBank Gene ID M27602
GeneCard ID PRSS2
GenAtlas ID PRSS2
HGNC ID HGNC:9483
References
General References
  1. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  2. Emi M, Nakamura Y, Ogawa M, Yamamoto T, Nishide T, Mori T, Matsubara K: Cloning, characterization and nucleotide sequences of two cDNAs encoding human pancreatic trypsinogens. Gene. 1986;41(2-3):305-10. [PubMed:3011602 ]
  3. Kimland M, Russick C, Marks WH, Borgstrom A: Immunoreactive anionic and cationic trypsin in human serum. Clin Chim Acta. 1989 Sep 15;184(1):31-46. [PubMed:2598466 ]
  4. Sahin-Toth M, Kukor Z, Nemoda Z: Human cationic trypsinogen is sulfated on Tyr154. FEBS J. 2006 Nov;273(22):5044-50. [PubMed:17087724 ]