You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08088
Secondary Accession Numbers
  • 13799
Name Trypsin-3
Synonyms
  1. Brain trypsinogen
  2. Mesotrypsinogen
  3. Serine protease 3
  4. Serine protease 4
  5. Trypsin III
  6. Trypsin IV
Gene Name PRSS3
Protein Type Unknown
Biological Properties
General Function Involved in serine-type endopeptidase activity
Specific Function Preferential cleavage:Arg-|-Xaa, Lys-|-Xaa
Pathways Not Available
Reactions Not Available
GO Classification
Function
endopeptidase activity
serine-type endopeptidase activity
catalytic activity
hydrolase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:9
Locus 9p11.2
SNPs PRSS3
Gene Sequence
>915 bp
ATGTGCGGACCTGACGACAGATGCCCCGCACGCTGGCCGGGACCGGGAAGGGCGGTCAAG
TGTGGAAAGGGTCTGGCGGCTGCCAGGCCTGGCAGAGTGGAGCGGGGCGGGGCGCAGCGG
GGCGGGGCGGGCCTGGAGCTGCACCCGCTTCTGGGTGGACGCACTTGGCGAGCGGCGCGG
GATGCAGACGGCTGCGAGGCGCTGGGCACAGTTGCTGTCCCCTTTGACGATGATGACAAG
ATTGTTGGGGGCTACACCTGTGAGGAGAATTCTCTCCCCTACCAGGTGTCCCTGAATTCT
GGCTCCCACTTCTGCGGTGGCTCCCTCATCAGCGAACAGTGGGTGGTATCAGCAGCTCAC
TGCTACAAGACCCGCATCCAGGTGAGACTGGGAGAGCACAACATCAAAGTCCTGGAGGGG
AATGAGCAGTTCATCAATGCGGCCAAGATCATCCGCCACCCTAAATACAACAGGGACACT
CTGGACAATGACATCATGCTGATCAAACTCTCCTCACCTGCCGTCATCAATGCCCGCGTG
TCCACCATCTCTCTGCCCACCACCCCTCCAGCTGCTGGCACTGAGTGCCTCATCTCCGGC
TGGGGCAACACTCTGAGCTTTGGTGCTGACTACCCAGACGAGCTGAAGTGCCTGGATGCT
CCGGTGCTGACCCAGGCTGAGTGTAAAGCCTCCTACCCTGGAAAGATTACCAACAGCATG
TTCTGTGTGGGCTTCCTTGAGGGAGGCAAGGATTCCTGCCAGCGTGACTCTGGTGGCCCT
GTGGTCTGCAACGGACAGCTCCAAGGAGTTGTCTCCTGGGGCCATGGCTGTGCCTGGAAG
AACAGGCCTGGAGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAGGACACCATC
GCTGCCAACAGCTAA
Protein Properties
Number of Residues 304
Molecular Weight 32528.6
Theoretical pI 7.54
Pfam Domain Function
Signals
  • 1-
Transmembrane Regions
  • None
Protein Sequence
>Trypsin-3
MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAAR
DADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
CYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARV
STISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSM
FCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTI
AANS
GenBank ID Protein 57162227
UniProtKB/Swiss-Prot ID P35030
UniProtKB/Swiss-Prot Entry Name TRY3_HUMAN
PDB IDs
GenBank Gene ID AL139113
GeneCard ID PRSS3
GenAtlas ID PRSS3
HGNC ID HGNC:9486
References
General References
  1. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  2. Wiegand U, Corbach S, Minn A, Kang J, Muller-Hill B: Cloning of the cDNA encoding human brain trypsinogen and characterization of its product. Gene. 1993 Dec 22;136(1-2):167-75. [PubMed:8294000 ]
  3. Tani T, Kawashima I, Mita K, Takiguchi Y: Nucleotide sequence of the human pancreatic trypsinogen III cDNA. Nucleic Acids Res. 1990 Mar 25;18(6):1631. [PubMed:2326201 ]
  4. Katona G, Berglund GI, Hajdu J, Graf L, Szilagyi L: Crystal structure reveals basis for the inhibitor resistance of human brain trypsin. J Mol Biol. 2002 Feb 1;315(5):1209-18. [PubMed:11827488 ]