Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08090
Secondary Accession Numbers
  • 13801
Name Alpha-taxilin
Synonyms Not Available
Gene Name TXLNA
Protein Type Unknown
Biological Properties
General Function Cell cycle control, cell division, chromosome partitioning
Specific Function May be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 1p35.1
SNPs TXLNA
Gene Sequence
>1641 bp
ATGAAGAACCAAGACAAAAAGAACGGGGCTGCCAAACAATCCAATCCAAAAAGCAGCCCA
GGACAACCGGAAGCAGGACCCGAGGGAGCCCAGGAGCGGCCCAGCCAGGCGGCTCCTGCA
GTAGAAGCAGAAGGTCCCGGCAGCAGCCAGGCTCCTCGGAAGCCGGAGGGGGCTCAAGCC
AGAACGGCTCAGTCTGGGGCCCTTCGTGATGTCTCTGAGGAGCTGAGCCGCCAACTGGAA
GACATACTGAGCACATACTGTGTGGACAATAACCAGGGGGGCCCCGGCGAGGATGGGGCA
CAGGGTGAGCCGGCTGAACCCGAAGATGCAGAGAAGTCCCGGACCTATGTGGCAAGGAAT
GGGGAGCCTGAACCAACTCCAGTAGTCAATGGAGAGAAGGAACCCTCCAAGGGGGATCCA
AACACAGAAGAGATCCGGCAGAGTGACGAGGTCGGAGACCGAGACCATCGAAGGCCACAG
GAGAAGAAAAAAGCCAAGGGTTTGGGGAAGGAGATCACGTTGCTGATGCAGACATTGAAT
ACTCTGAGTACCCCAGAGGAGAAGCTGGCTGCTCTGTGCAAGAAGTATGCTGAACTGCTG
GAGGAGCACCGGAATTCACAGAAGCAGATGAAGCTCCTACAGAAAAAGCAGAGCCAGCTG
GTGCAAGAGAAGGACCACCTGCGCGGTGAGCACAGCAAGGCCGTCCTGGCCCGCAGCAAG
CTTGAGAGCCTATGCCGTGAGCTGCAGCGGCACAACCGCTCCCTCAAGGAAGAAGGTGTG
CAGCGGGCCCGGGAGGAGGAGGAGAAGCGCAAGGAGGTGACCTCGCACTTCCAGGTGACA
CTGAATGACATTCAGCTGCAGATGGAACAGCACAATGAGCGCAACTCCAAGCTGCGCCAA
GAGAACATGGAGCTGGCTGAGAGGCTCAAGAAGCTGATTGAGCAGTATGAGCTGCGCGAG
GAGCATATCGACAAAGTCTTCAAACACAAGGACCTACAACAGCAGCTGGTGGATGCCAAG
CTCCAGCAGGCCCAGGAGATGCTAAAGGAGGCAGAAGAGCGGCACCAGCGGGAGAAGGAT
TTTCTCCTGAAAGAGGCAGTAGAGTCCCAGAGGATGTGTGAGCTGATGAAGCAGCAAGAG
ACCCACCTGAAGCAACAGCTTGCCCTATACACAGAGAAGTTTGAGGAGTTCCAGAACACA
CTTTCCAAAAGCAGCGAGGTATTCACCACATTCAAGCAGGAGATGGAAAAGATGACTAAG
AAGATCAAGAAGCTGGAGAAAGAAACCACCATGTACCGGTCCCGGTGGGAGAGCAGCAAC
AAGGCCCTGCTTGAGATGGCTGAGGAGAAAACAGTCCGGGATAAAGAACTGGAGGGCCTG
CAGGTAAAAATCCAACGGCTGGAGAAGCTGTGCCGGGCACTGCAGACAGAGCGCAATGAC
CTGAACAAGAGGGTACAGGACCTGAGTGCTGGTGGCCAGGGCTCCCTCACTGACAGTGGC
CCTGAGAGGAGGCCAGAGGGGCCTGGGGCTCAAGCACCCAGCTCCCCCAGGGTCACAGAA
GCGCCTTGCTACCCAGGAGCACCGAGCACAGAAGCATCAGGCCAGACTGGGCCTCAAGAG
CCCACCTCCGCCAGGGCCTAG
Protein Properties
Number of Residues 546
Molecular Weight 61890.8
Theoretical pI 6.47
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Alpha-taxilin
MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQA
RTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARN
GEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKKKAKGLGKEITLLMQTLN
TLSTPEEKLAALCKKYAELLEEHRNSQKQMKLLQKKQSQLVQEKDHLRGEHSKAVLARSK
LESLCRELQRHNRSLKEEGVQRAREEEEKRKEVTSHFQVTLNDIQLQMEQHNERNSKLRQ
ENMELAERLKKLIEQYELREEHIDKVFKHKDLQQQLVDAKLQQAQEMLKEAEERHQREKD
FLLKEAVESQRMCELMKQQETHLKQQLALYTEKFEEFQNTLSKSSEVFTTFKQEMEKMTK
KIKKLEKETTMYRSRWESSNKALLEMAEEKTVRDKELEGLQVKIQRLEKLCRALQTERND
LNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQE
PTSARA
GenBank ID Protein 28394224
UniProtKB/Swiss-Prot ID P40222
UniProtKB/Swiss-Prot Entry Name TXLNA_HUMAN
PDB IDs Not Available
GenBank Gene ID AF516206
GeneCard ID TXLNA
GenAtlas ID TXLNA
HGNC ID HGNC:30685
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  8. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  9. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  10. Nogami S, Satoh S, Nakano M, Shimizu H, Fukushima H, Maruyama A, Terano A, Shirataki H: Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells. Genes Cells. 2003 Jan;8(1):17-28. [PubMed:12558796 ]
  11. Ambrus JL Jr, Pippin J, Joseph A, Xu C, Blumenthal D, Tamayo A, Claypool K, McCourt D, Srikiatchatochorn A, Ford RJ: Identification of a cDNA for a human high-molecular-weight B-cell growth factor. Proc Natl Acad Sci U S A. 1993 Jul 1;90(13):6330-4. [PubMed:8327514 ]
  12. Ambrus JL Jr, Pippin J, Joseph A, Xu C, Blumenthal D, Tamayo A, Claypool K, McCourt D, Srikiatchatochorn A, Ford R: Identification of a cDNA for a human high molecular-weight B-cell growth factor. Proc Natl Acad Sci U S A. 1996 Jul 23;93(15):8154. [PubMed:8755619 ]
  13. Nogami S, Satoh S, Nakano M, Terano A, Shirataki H: Interaction of taxilin with syntaxin which does not form the SNARE complex. Biochem Biophys Res Commun. 2003 Nov 28;311(4):797-802. [PubMed:14623251 ]