Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08093
Secondary Accession Numbers
  • 13804
Name UDP-glucose:glycoprotein glucosyltransferase 1
Synonyms
  1. UDP--Glc:glycoprotein glucosyltransferase
  2. UDP-glucose ceramide glucosyltransferase-like 1
  3. UGT1
  4. hUGT1
Gene Name UGGT1
Protein Type Unknown
Biological Properties
General Function Involved in UDP-glucose:glycoprotein glucosyltransferase activity
Specific Function Recognizes glycoproteins with minor folding defects. Reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognized by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation
Pathways Not Available
Reactions Not Available
GO Classification
Function
udp-glucose:glycoprotein glucosyltransferase activity
catalytic activity
transferase activity
udp-glycosyltransferase activity
transferase activity, transferring glycosyl groups
udp-glucosyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid glycosylation
Cellular Location
  1. Endoplasmic reticulum lumen
  2. Endoplasmic reticulum-Golgi intermediate compartment
Gene Properties
Chromosome Location Chromosome:2
Locus 2q14.3
SNPs UGGT1
Gene Sequence
>4668 bp
ATGGGCTGCAAGGGAGACGCGAGCGGTGCGTGTGCCGCGGGTGCGCTGCCGGTGACAGGA
GTTTGCTATAAAATGGGAGTTCTGGTTGTACTCACTGTTCTGTGGCTGTTCTCCTCAGTA
AAGGCCGACTCAAAAGCCATTACAACCTCTCTTACAACAAAATGGTTTTCCACTCCATTG
TTGTTAGAAGCCAGTGAGTTTTTAGCAGAAGACAGTCAAGAGAAATTTTGGAATTTTGTA
GAAGCCAGTCAAAATATTGGATCATCAGATCATGACGGTACCGATTATTCCTACTATCAT
GCAATATTGGAGGCTGCATTTCAGTTTCTGTCACCCCTCCAGCAGAATTTGTTTAAATTT
TGTCTGTCCCTTCGTTCTTACTCAGCTACAATCCAAGCCTTCCAGCAGATAGCAGCTGAT
GAACCTCCACCAGAAGGATGTAATTCGTTTTTTTCAGTGCATGGAAAGAAGACTTGTGAA
TCTGATACCCTTGAGGCTCTTCTACTGACAGCCTCTGAAAGACCCAAACCTTTATTGTTC
AAAGGAGATCACAGATATCCCTCGTCTAATCCTGAAAGCCCTGTGGTGATTTTCTACTCT
GAGATTGGCTCTGAGGAATTTTCCAATTTTCACCGCCAGCTTATATCAAAAAGCAATGCA
GGCAAAATCAATTATGTATTCAGACATTATATATTTAATCCCAGGAAGGAGCCTGTTTAC
CTCTCTGGCTATGGCGTGGAATTGGCCATTAAGAGCACTGAGTACAAGGCCAAGGATGAT
ACTCAGGTGAAAGGAACTGAGGTAAACACCACAGTGATTGGTGAAAATGATCCTATTGAT
GAGGTTCAGGGGTTCCTCTTTGGAAAATTAAGAGATCTGCACCCCGACCTGGAGGGACAG
TTGAAAGAACTCAGAAAGCATCTTGTAGAGAGCACCAATGAAATGGCACCTTTAAAGGTT
TGGCAGTTGCAAGATCTCAGTTTCCAGACTGCTGCTCGAATCTTGGCTTCTCCTGTTGAG
TTGGCTTTGGTTGTCATGAAGGATCTTAGTCAGAATTTTCCTACCAAAGCCAGAGCAATA
ACAAAAACAGCTGTGAGCTCAGAACTTAGAACCGAAGTGGAAGAGAATCAGAAGTATTTC
AAGGGAACTTTAGGATTACAACCTGGAGATTCAGCCCTCTTCATCAATGGACTTCACATG
GATTTAGATACACAGGATATATTCAGTCTGTTTGATGTGTTGAGGAATGAAGCTCGGGTA
ATGGAGGGTCTGCATAGATTGGGAATAGAAGGCCTTTCTCTGCATAATGTTTTGAAGCTG
AACATCCAGCCCTCTGAGGCAGACTATGCCGTAGACATCCGGAGTCCTGCTATTTCATGG
GTCAACAACCTGGAGGTTGATAGCAGATATAATTCGTGGCCTTCTAGTTTACAAGAGTTG
CTTCGACCCACCTTTCCTGGTGTTATTCGGCAGATCAGGAAAAACTTACATAATATGGTT
TTCATAGTTGATCCTGCACATGAGACCACAGCAGAGTTGATGAACACAGCTGAGATGTTC
CTTAGTAATCATATACCACTAAGAATTGGTTTTATCTTTGTGGTTAATGACTCTGAAGAT
GTTGATGGGATGCAAGATGCTGGAGTGGCTGTTCTTAGAGCATATAATTATGTTGCCCAA
GAAGTGGATGATTATCATGCCTTCCAGACTCTGACACATATCTATAACAAGGTGAGGACT
GGAGAAAAAGTGAAAGTTGAACATGTGGTCAGTGTCCTGGAGAAGAAATATCCGTATGTA
GAAGTGAATAGCATTTTGGGGATTGATTCTGCTTATGATCGGAATCGGAAGGAAGCAAGA
GGCTACTATGAGCAGACTGGAGTTGGACCTCTGCCCGTTGTGCTGTTCAATGGAATGCCC
TTTGAAAGGGAACAGCTAGACCCTGATGAGTTAGAAACCATCACAATGCATAAAATCCTG
GAGACCACCACCTTCTTCCAAAGAGCGGTGTACTTGGGTGAACTGCCCCATGATCAAGAT
GTGGTAGAGTATATCATGAATCAGCCAAATGTTGTTCCACGAATCAATTCTAGGATTTTG
ACAGCTGAACGAGACTACCTGGATTTAACAGCGAGTAATAACTTCTTTGTGGATGATTAT
GCTAGATTTACTATCTTGGATTCCCAAGGCAAGACTGCTGCTGTAGCCAATAGTATGAAC
TATCTGACAAAGAAAGGAATGTCCTCCAAGGAAATCTATGATGATTCTTTTATTAGGCCA
GTAACTTTTTGGATTGTTGGGGATTTTGATAGCCCTTCTGGACGGCAGTTACTGTATGAT
GCCATCAAACATCAGAAATCCAGTAACAATGTTAGAATAAGCATGATCAATAATCCTGCC
AAAGAGATAAGCTATGAGAACACTCAGATCTCCAGAGCAATCTGGGCAGCTCTCCAAACT
CAGACTTCCAACGCTGCTAAGAACTTCATCACCAAAATGGCCAAGGAGGGGGCTGCAGAG
GCCCTGGCTGCAGGAGCTGACATTGCGGAGTTCTCTGTTGGGGGAATGGATTTCAGTCTT
TTTAAAGAGGTCTTTGAGTCTTCCAAAATGGATTTCATTTTGTCTCATGCCGTGTACTGC
AGGGATGTTCTGAAGCTGAAGAAGGGACAGAGGGCAGTGATCAGCAATGGAAGGATCATT
GGGCCACTGGAGGATAGTGAGCTCTTTAATCAAGACGATTTCCACCTCCTCGAAAATATC
ATCTTAAAAACCTCAGGACAGAAAATAAAATCTCATATTCAACAGCTTCGGGTAGAAGAA
GATGTGGCAAGCGACTTGGTAATGAAGGTGGATGCTCTTCTGTCAGCGCAACCAAAAGGA
GATCCAAGAATCGAGTACCAGTTTTTTGAAGACAGACACAGTGCAATCAAACTGAGGCCG
AAGGAAGGGGAGACATACTTTGATGTTGTGGCTGTCGTTGACCCTGTCACCAGAGAAGCA
CAGAGACTTGCTCCTTTGCTCTTGGTTTTGGCTCAGCTGATAAACATGAATCTGAGAGTA
TTTATGAACTGCCAATCCAAACTTTCTGACATGCCTTTAAAAAGCTTTTACCGTTATGTC
TTAGAACCAGAGATTTCTTTCACTTCAGACAATAGTTTTGCTAAGGGTCCAATCGCAAAA
TTTTTGGATATGCCTCAGTCTCCACTGTTCACTCTGAATTTGAACACACCTGAGAGCTGG
ATGGTAGAATCTGTCAGAACACCATATGATCTTGATAATATTTATTTAGAAGAGGTGGAC
AGTGTAGTGGCTGCTGAGTATGAGCTGGAATACCTGTTACTGGAAGGTCATTGCTACGAC
ATCACCACAGGCCAGCCTCCACGGGGACTACAGTTTACCTTAGGAACTTCAGCCAACCCG
GTCATTGTGGACACCATTGTTATGGCCAATCTGGGCTACTTTCAGCTGAAAGCCAACCCA
GGAGCTTGGATCCTCAGACTTAGGAAGGGACGCTCTGAAGATATTTATAGAATTTACAGC
CACGATGGCACTGATTCTCCCCCTGATGCTGATGAGGTGGTTATCGTCCTCAACAACTTC
AAAAGCAAAATTATTAAAGTGAAGGTTCAGAAGAAGGCAGATATGGTGAACGAAGACTTG
CTGAGTGATGGAACGAGTGAGAATGAATCTGGATTTTGGGATTCCTTCAAATGGGGCTTT
ACAGGACAGAAGACTGAGGAAGTGAAGCAAGATAAAGATGACATAATTAATATTTTCTCC
GTTGCATCTGGTCATCTCTACGAAAGATTTCTTCGCATAATGATGCTATCCGTGCTGAAG
AATACCAAGACTCCTGTGAAATTCTGGTTCTTGAAGAATTACTTGTCCCCCACATTTAAG
GAGTTTATACCTTACATGGCAAATGAATACAATTTCCAGTATGAGCTTGTTCAGTACAAA
TGGCCCCGGTGGCTTCATCAACAAACTGAAAAACAGCGTATCATCTGGGGTTACAAGATC
CTCTTCCTGGATGTACTTTTCCCACTAGTTGTTGACAAGTTCCTGTTTGTGGATGCTGAT
CAGATTGTACGAACAGATCTGAAAGAGTTAAGAGATTTCAATTTGGATGGTGCTCCTTAT
GGTTACACTCCTTTCTGTGACAGCCGAAGAGAAATGGACGGCTACAGGTTCTGGAAGTCA
GGGTACTGGGCCAGTCATTTAGCCGGGCGAAAGTATCATATCAGTGCACTATATGTTGTG
GATCTGAAGAAGTTTAGGAAAATAGCTGCTGGTGACAGACTCAGGGGACAGTACCAAGGT
CTGAGTCAGGACCCTAACAGCCTTTCAAATCTTGATCAAGATCTGCCCAATAACATGATT
CATCAGGTGCCAATTAAATCCCTCCCTCAAGAATGGCTTTGGTGTGAAACGTGGTGTGAT
GACGCCTCTAAGAAAAGGGCAAAAACCATTGATTTGTGTAATAATCCGATGACCAAAGAG
CCGAAACTGGAAGCAGCTGTGCGGATTGTCCCGGAGTGGCAGGACTACGACCAAGAGATC
AAACAGCTACAGATCCGCTTTCAGAAGGAGAAAGAAACGGGAGCACTGTACAAAGAGAAG
ACAAAAGAACCAAGCCGAGAAGGTCCTCAGAAACGTGAAGAATTATGA
Protein Properties
Number of Residues 1555
Molecular Weight 177188.0
Theoretical pI 5.32
Pfam Domain Function
Signals
  • 1-42
Transmembrane Regions
  • None
Protein Sequence
>UDP-glucose:glycoprotein glucosyltransferase 1
MGCKGDASGACAAGALPVTGVCYKMGVLVVLTVLWLFSSVKADSKAITTSLTTKWFSTPL
LLEASEFLAEDSQEKFWNFVEASQNIGSSDHDGTDYSYYHAILEAAFQFLSPLQQNLFKF
CLSLRSYSATIQAFQQIAADEPPPEGCNSFFSVHGKKTCESDTLEALLLTASERPKPLLF
KGDHRYPSSNPESPVVIFYSEIGSEEFSNFHRQLISKSNAGKINYVFRHYIFNPRKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNTTVIGENDPIDEVQGFLFGKLRDLHPDLEGQ
LKELRKHLVESTNEMAPLKVWQLQDLSFQTAARILASPVELALVVMKDLSQNFPTKARAI
TKTAVSSELRTEVEENQKYFKGTLGLQPGDSALFINGLHMDLDTQDIFSLFDVLRNEARV
MEGLHRLGIEGLSLHNVLKLNIQPSEADYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIVDPAHETTAELMNTAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAQEVDDYHAFQTLTHIYNKVRTGEKVKVEHVVSVLEKKYPYV
EVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKIL
ETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDY
ARFTILDSQGKTAAVANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQKSSNNVRISMINNPAKEISYENTQISRAIWAALQTQTSNAAKNFITKMAKEGAAE
ALAAGADIAEFSVGGMDFSLFKEVFESSKMDFILSHAVYCRDVLKLKKGQRAVISNGRII
GPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKG
DPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPVTREAQRLAPLLLVLAQLINMNLRV
FMNCQSKLSDMPLKSFYRYVLEPEISFTSDNSFAKGPIAKFLDMPQSPLFTLNLNTPESW
MVESVRTPYDLDNIYLEEVDSVVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANP
VIVDTIVMANLGYFQLKANPGAWILRLRKGRSEDIYRIYSHDGTDSPPDADEVVIVLNNF
KSKIIKVKVQKKADMVNEDLLSDGTSENESGFWDSFKWGFTGQKTEEVKQDKDDIINIFS
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYK
WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPY
GYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQG
LSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
PKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL
GenBank ID Protein 9910280
UniProtKB/Swiss-Prot ID Q9NYU2
UniProtKB/Swiss-Prot Entry Name UGGG1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020120.3
GeneCard ID UGGT1
GenAtlas ID UGGT1
HGNC ID HGNC:15663
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  5. Arnold SM, Fessler LI, Fessler JH, Kaufman RJ: Two homologues encoding human UDP-glucose:glycoprotein glucosyltransferase differ in mRNA expression and enzymatic activity. Biochemistry. 2000 Mar 7;39(9):2149-63. [PubMed:10694380 ]