You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08095
Secondary Accession Numbers
  • 13806
Name Protein unc-13 homolog B
Synonyms
  1. Munc13-2
  2. munc13
Gene Name UNC13B
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity- depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Peripheral membrane protein
  4. Membrane
  5. Cell junction
  6. synapse
Gene Properties
Chromosome Location Chromosome:9
Locus 9p13.3
SNPs UNC13B
Gene Sequence
>4776 bp
ATGTCACTGCTCTGCGTGCGCGTTAAAAGGGCCAAATTCCAGGGTTCACCAGATAAATTT
AACACATATGTGACCCTGAAAGTACAGAATGTGAAGAGCACAACTGTAGCAGTTCGTGGT
GATCAGCCTTCCTGGGAACAGGATTTCATGTTTGAGATTAGTCGCCTGGACCTGGGTCTA
AGTGTGGAGGTATGGAACAAAGGACTGATCTGGGACACCATGGTGGGGACTGTGTGGATT
GCGCTGAAGACTATTCGTCAGTCGGATGAGGAAGGGCCTGGGGAATGGTCCACATTAGAG
GCAGAGACGTTAATGAAAGACGATGAGATCTGTGGAACTAGAAACCCAACTCCTCATAAA
ATTTTGCTTGATACAAGATTTGAGTTGCCTTTTGATATCCCAGAGGAGGAAGCCAGATAT
TGGACCTACAAATGGGAGCAAATCAATGCCTTGGGAGCTGACAATGAGTATTCTAGTCAA
GAAGAAAGCCAGAGGAAGCCATTGCCCACTGCTGCCGCCCAGTGTTCTTTTGAAGACCCT
GATAGTGCCGTCGATGACCGAGATAGTGACTATCGCAGTGAGACCAGCAACAGCTTCCCA
CCTCCTTACCATACAGCTTCCCAGCCCAACGCTTCTGTGCACCAGTTCCCTGTGCCGGTG
CGATCGCCACAGCAGCTGCTACTTCAAGGCAGTTCCCGGGACTCTTGTAATGACTCTATG
CAAAGTTATGACCTTGATTATCCAGAGCGGCGGGCTATCAGCCCCACCAGCAGCAGTAGG
TATGGCTCCTCCTGTAATGTGAGTCAAGGAAGCTCTCAGCTAAGTGAACTAGACCAGTAT
CACGAACAAGATGACGACCATCGGGAGACGGACTCGATTCATTCTTGCCACAGCTCTCAC
AGCCTGTCCAGAGATGGCCAAGCAGGTTTTGGAGAACAAGAGAAACCCTTGGAGGTGACA
GGTCAAGCAGAGAAGGAGGCAGCATGTGAACCCAAGGAGATGAAAGAAGATGCCACAACC
CACCCTCCCCCAGATCTGGTGCTGCAAAAAGACCACTTCCTAGGTCCCCAGGAGAGTTTT
CCTGAGGAGAATGCATCTTCACCATTTACCCAAGCCAGAGCACATTGGATCCGAGCAGTT
ACCAAGGTTCGACTCCAGCTGCAGGAGATTCCAGATGATGGTGACCCCTCTCTGCCTCAG
TGGCTCCCGGAAGGGCCAGCCGGAGGGCTCTATGGCATTGACAGCATGCCAGATTTACGC
AGAAAGAAGCCACTGCCACTTGTCAGTGATCTGTCACTGGTCCAGTCTCGGAAGGCAGGA
ATCACTTCTGCAATGGCTACACGCACTTCTCTTAAGGACGAAGAGCTGAAATCCCACGTG
TATAAGAAAACCCTGCAGGCCTTAATCTACCCCATTTCGTGCACCACTCCTCATAACTTT
GAGGTCTGGACGGCCACTACCCCAACCTACTGCTATGAGTGTGAAGGCCTGCTCTGGGGC
ATTGCCCGGCAGGGCATGCGCTGCAGCGAATGTGGAGTCAAGTGCCATGAGAAGTGCCAG
GATCTGCTCAATGCTGACTGCCTGCAGCGGGCTGCAGAAAAGAGCTGTAAACATGGAGCT
GAGGACCGGACCCAGAACATTATCATGGCCATGAAGGACCGCATGAAGATCCGAGAGCGA
AATAAGCCAGAGATCTTTGAAGTTATCCGGGACGTCTTCACAGTGAACAAAGCTGCCCAT
GTGCAGCAGATGAAAACAGTGAAGCAGAGTGTACTGGATGGCACCTCCAAGTGGTCAGCC
AAGATCACCATTACTGTGGTGTGTGCCCAGGGCCTACAAGCCAAGGACAAAACAGGATCC
AGTGACCCTTACGTGACTGTGCAAGTCAGCAAAACTAAGAAGCGTACCAAGACCATTTTT
GGAAACTTGAATCCTGTTTGGGAGGAGAAGTTCCATTTTGAGTGCCACAACTCCTCTGAC
CGCATTAAGGTGCGTGTATGGGATGAGGATGATGACATCAAGTCAAGAGTAAAGCAACGC
CTAAAGCGAGAGTCTGATGATTTCCTTGGCCAAACCATCATTGAGGTTCGGACCCTAAGT
GGCGAGATGGACGTCTGGTACAACTTGGAGAAGAGGACAGACAAATCAGCCGTCTCAGGG
GCTATCCGACTACAAATCAGTGTGGAGATCAAGGGGGAGGAGAAAGTAGCCCCATACCAC
GTGCAGTATACATGTCTCCATGAGAATCTTTTCCATTACCTCACAGACATTCAGGGCAGT
GGAGGAGTCCGCATCCCTGAAGCTCGAGGAGACGATGCCTGGAAGGTGTACTTTGATGAG
ACAGCCCAAGAAATTGTGGATGAATTTGCCATGCGTTATGGCATTGAGTCCATATATCAG
GCCATGACGCACTTTGCATGTTTATCATCCAAGTACATGTGTCCTGGTGTGCCAGCAGTG
ATGAGCACCTTACTGGCCAACATCAACGCCTACTATGCCCACACAACTGCCTCTACCAAT
GTCTCTGCATCTGATCGCTTTGCAGCCTCCAACTTTGGGAAAGAGAGATTTGTAAAACTG
CTGGACCAGCTACACAACTCACTGAGGATCGACCTCTCTACATACAGGAATAATTTCCCT
GCTGGGAGTCCTGAACGGCTTCAGGACTTAAAATCCACAGTGGATTTGCTGACCAGCATT
ACTTTCTTCAGAATGAAGGTACAAGAACTGCAAAGCCCTCCAAGAGCCAGCCAGGTGGTA
AAGGATTGTGTGAAGGCCTGTTTGAACTCCACATATGAATATATCTTCAACAACTGCCAC
GACTTATACAGCCGCCAGTACCAGCTGAAGCAGGAGCTACCTCCAGAGGAACAAGGGCCC
AGCATTCGGAACCTGGATTTCTGGCCCAAGCTCATCACACTCATCGTGTCAATCATAGAG
GAAGATAAGAATTCCTACACACCTGTTCTGAACCAGTTTCCTCAGGAGTTGAATGTGGGA
AAAGTCAGCGCAGAAGTGATGTGGCATTTGTTTGCCCAAGACATGAAATATGCATTGGAG
GAGCATGAGAAAGACCACCTGTGTAAAAGTGCTGACTACATGAACCTGCACTTCAAGGTG
AAGTGGCTCCACAATGAATACGTGCGGGATCTGCCTGTCCTCCAGGGGCAGGTGCCTGAG
TACCCAGCGTGGTTTGAGCAGTTCGTGCTACAATGGCTGGATGAGAATGAGGATGTATCC
CTGGAATTCCTGCGTGGGGCCCTGGAACGAGATAAGAAGGATGGATTCCAGCAGACATCA
GAGCATGCACTCTTTTCCTGCTCTGTGGTGGATGTCTTCACACAACTCAATCAGAGCTTT
GAGATCATCCGGAAGCTGGAATGCCCAGACCCCAGCATCCTTGCCCACTACATGAGGAGG
TTTGCTAAGACCATCGGGAAGGTGCTGATGCAGTATGCAGACATCTTGTCAAAGGACTTC
CCAGCCTATTGCACAAAGGAGAAACTGCCCTGCATCCTGATGAACAACGTGCAGCAACTG
AGGGTCCAGCTGGAGAAAATGTTTGAGGCCATGGGAGGCAAGGAGCTGGACCTTGAAGCT
GCAGACAGTCTGAAGGAGCCGCAGGTGAAACTGAATACGGTTCTGGATGAGCTCAGCATG
GTGTTTGGAAACAGTTTCCAGGTACGGATTGATGAGTGTGTTCGACAAATGGCCGACATC
CTGGGCCAGGTTCGGGGCACAGGGAATGCATCTCCAGACGCCAGGGCCTCAGCGGCTCAG
GATGCAGATAGCGTACTCCGGCCTCTCATGGACTTCCTGGATGGCAACCTCACCCTCTTT
GCCACTGTGTGTGAGAAGACGGTTCTGAAGCGTGTACTGAAGGAGCTCTGGCGCGTGGTG
ATGAACACAATGGAGAGGATGATTGTTCTGCCCCCACTCACTGACCAGACGGGCACCCAG
CTGATCTTCACTGCTGCCAAGGAGCTGAGCCATCTTTCCAAACTCAAGGATCACATGGTA
CGAGAGGAAACACGGAATCTCACTCCAAAGCAGTGTGCAGTCCTTGACCTCGCCCTGGAC
ACCATCAAGCAATACTTCCATGCAGGAGGCAATGGGCTGAAGAAAACCTTCCTGGAGAAG
AGCCCAGATCTGCAGTCTCTACGCTATGCCCTGTCTCTGTACACACAGACTACTGACACT
CTCATCAAGAGGTTTGTGCGCTCGCAGACCACCCAAGGGTCTGGTGTGGACGATCCTGTG
GGAGAAGTCTCTATTCAGGTGGACTTGTTTACACACCCTGGTACTGGGGAGCACAAGGTC
ACAGTGAAAGTGGTGGCTGCCAATGACCTCAAGTGGCAGACAGCGGGTATGTTCCGGCCT
TTCGTGGAGGTGACTATGGTTGGCCCACACCAAAGTGATAAGAAGAGGAAGTTCACAACC
AAATCCAAAAGCAACAACTGGGCCCCCAAGTACAATGAGACATTCCACTTACTCCTGGGA
AATGAGGAGGGGCCCGAGTCCTATGAGTTGCAGATATGCGTGAAGGATTACTGCTTTGCC
CGGGAAGATCGCGTGCTAGGGCTGGCTGTGATGCCTCTGAGGGATGTCACAGCCAAGGGC
AGCTGTGCCTGCTGGTGCCCCTTGGGCCGGAAGATCCATATGGATGAGACAGGCCTGACC
ATTCTCCGGATTTTATCTCAGAGGAGCAATGACGAGGTGGCCCGAGAATTTGTGAAACTC
AAATCAGAGTCTCGTTCCACGGAGGAGGGGAGCTGA
Protein Properties
Number of Residues 1591
Molecular Weight 180677.2
Theoretical pI 5.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein unc-13 homolog B
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKDDEICGTRNPTPHK
ILLDTRFELPFDIPEEEARYWTYKWEQINALGADNEYSSQEESQRKPLPTAAAQCSFEDP
DSAVDDRDSDYRSETSNSFPPPYHTASQPNASVHQFPVPVRSPQQLLLQGSSRDSCNDSM
QSYDLDYPERRAISPTSSSRYGSSCNVSQGSSQLSELDQYHEQDDDHRETDSIHSCHSSH
SLSRDGQAGFGEQEKPLEVTGQAEKEAACEPKEMKEDATTHPPPDLVLQKDHFLGPQESF
PEENASSPFTQARAHWIRAVTKVRLQLQEIPDDGDPSLPQWLPEGPAGGLYGIDSMPDLR
RKKPLPLVSDLSLVQSRKAGITSAMATRTSLKDEELKSHVYKKTLQALIYPISCTTPHNF
EVWTATTPTYCYECEGLLWGIARQGMRCSECGVKCHEKCQDLLNADCLQRAAEKSCKHGA
EDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVNKAAHVQQMKTVKQSVLDGTSKWSA
KITITVVCAQGLQAKDKTGSSDPYVTVQVSKTKKRTKTIFGNLNPVWEEKFHFECHNSSD
RIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSG
AIRLQISVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVRIPEARGDDAWKVYFDE
TAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLANINAYYAHTTASTN
VSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERLQDLKSTVDLLTSI
TFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSRQYQLKQELPPEEQGP
SIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMWHLFAQDMKYALE
EHEKDHLCKSADYMNLHFKVKWLHNEYVRDLPVLQGQVPEYPAWFEQFVLQWLDENEDVS
LEFLRGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLECPDPSILAHYMRR
FAKTIGKVLMQYADILSKDFPAYCTKEKLPCILMNNVQQLRVQLEKMFEAMGGKELDLEA
ADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTGNASPDARASAAQ
DADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERMIVLPPLTDQTGTQ
LIFTAAKELSHLSKLKDHMVREETRNLTPKQCAVLDLALDTIKQYFHAGGNGLKKTFLEK
SPDLQSLRYALSLYTQTTDTLIKTFVRSQTTQGSGVDDPVGEVSIQVDLFTHPGTGEHKV
TVKVVAANDLKWQTAGMFRPFVEVTMVGPHQSDKKRKFTTKSKSNNWAPKYNETFHFLLG
NEEGPESYELQICVKDYCFAREDRVLGLAVMPLRDVTAKGSCACWCPLGRKIHMDETGLT
ILRILSQRSNDEVAREFVKLKSESRSTEEGS
GenBank ID Protein 2432000
UniProtKB/Swiss-Prot ID O14795
UniProtKB/Swiss-Prot Entry Name UN13B_HUMAN
PDB IDs
GenBank Gene ID AF020202
GeneCard ID UNC13B
GenAtlas ID UNC13B
HGNC ID HGNC:12566
References
General References
  1. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Song Y, Ailenberg M, Silverman M: Cloning of a novel gene in the human kidney homologous to rat munc13s: its potential role in diabetic nephropathy. Kidney Int. 1998 Jun;53(6):1689-95. [PubMed:9607201 ]
  5. Song Y, Ailenberg M, Silverman M: Human munc13 is a diacylglycerol receptor that induces apoptosis and may contribute to renal cell injury in hyperglycemia. Mol Biol Cell. 1999 May;10(5):1609-19. [PubMed:10233166 ]