You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08096
Secondary Accession Numbers
  • 13807
Name Protein unc-13 homolog C
Synonyms
  1. Munc13-3
Gene Name UNC13C
Protein Type Unknown
Biological Properties
General Function Involved in intracellular signaling pathway
Specific Function Probably plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Probably is involved in neurotransmitter release
Pathways Not Available
Reactions Not Available
GO Classification
Process
intracellular signaling pathway
signaling
signaling pathway
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Peripheral membrane protein
  4. Membrane
  5. Cell junction
  6. synapse
  7. presynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q21.3
SNPs UNC13C
Gene Sequence
>6645 bp
ATGGTGGCTAATTTTTTCAAGAGCTTGATTTTACCTTACATTCATAAGCTTTGCAAAGGA
ATGTTTACAAAGAAATTGGGAAATACAAACAAAAACAAAGAGTATCGTCAGCAGAAAAAG
GATCAAGACTTCCCCACTGCTGGCCAGACCAAATCCCCCAAATTTTCTTACACTTTTAAA
AGCACTGTAAAGAAGATTGCAAAGTGTTCATCCACTCACAACTTATCCACTGAGGAAGAC
GAGGCCAGTAAAGAGTTTTCCCTCTCACCAACATTCAGTTACCGAGTAGCTATTGCCAAT
GGCCTACAAAAGAATGCTAAAGTAACCAACAGTGATAATGAGGATCTGCTTCAAGAGCTC
TCTTCAATCGAGAGTTCCTACTCAGAATCATTAAATGAACTAAGGAGTAGCACAGAAAAC
CAGGCACAATCAACACACACAATGCCAGTTAGACGCAACAGAAAGAGTTCAAGCAGCCTT
GCACCCTCTGAGGGCAGCTCTGACGGGGAGCGTACTCTACATGGCTTAAAACTGGGAGCT
TTACGAAAACTGAGAAAATGGAAAAAGAGTCAAGAATGTGTCTCCTCAGACTCAGAGTTA
AGCACCATGAAAAAATCCTGGGGAATAAGAAGTAAGTCTTTGGACAGAACTGTCCGAAAC
CCAAAGACAAATGCCCTGGAGCCAGGGTTCAGTTCCTCTGGCTGCATTAGCCAAACACAT
GATGTCATGGAAATGATCTTTAAGGAACTTCAGGGAATAAGTCAGATTGAAACAGAACTT
TCTGAACTACGAGGGCACGTCAATGCTCTCAAGCACTCCATCGATGAGATCTCCAGCAGT
GTGGAGGTTGTACAAAGTGAAATTGAGCAGTTGCGCACAGGGTTTGTCCAGTCTCGGAGG
GAAACTAGAGACATCCATGATTATATTAAGCACTTAGGTCATATGGGTAGCAAGGCAAGC
CTGAGATTTTTAAATGTGACTGAAGAAAGATTTGAATATGTTGAAAGCGTGGTGTACCAA
ATTCTAATAGATAAAATGGGTTTTTCAGATGCACCAAATGCTATTAAAATTGAATTTGCT
CAGAGGATAGGACACCAGAGAGACTGCCCAAATGCAAAGCCTCGACCCATACTTGTGTAC
TTTGAAACCCCTCAACAAAGGGATTCTGTCTTAAAAAAGTCATATAAACTCAAAGGAACA
GGCATTGGAATCTCAACAGATATTCTAACTCATGACATCAGAGAAAGAAAAGAGAAAGGG
ATACCATCCTCCCAGACATATGAGAGCATGGCTATAAAGTTGTCTACTCCAGAGCCAAAA
ATCAAGAAGAACAATTGGCAGTCACCTGATGACAGTGATGAAGATCTTGAATCTGACCTC
AATAGAAACAGTTACGCTGTGCTTTCCAAGTCAGAGCTTCTAACAAAGGGAAGTACTTCC
AAGCCAAGCTCAAAATCACACAGTGCTAGATCCAAGAATAAAACTGCTAATAGCAGCAGA
ATTTCAAATAAATCAGATTATGATAAAATCTCCTCACAGTTGCCAGAATCAGATATCTTG
GAAAAGCAAACCACAACCCATTATGCAGATGCAACACCTCTCTGGCACTCACAGAGTGAT
TTTTTCACTGCTAAACTTAGTCGTTCTGAATCAGATTTTTCCAAATTGTGTCAGTCTTAC
TCAGAAGATTTTTCAGAAAATCAGTTTTTCACTAGAACTAATGGAAGCTCTCTCCTGTCA
TCTTCGGACCGGGAGCTATGGCAGAGGAAACAGGAAGGAACAGCGACCCTGTATGACAGT
CCCAAGGACCAGCATTTGAATGGAGGTGTTCAGGGTATCCAAGGGCAGACTGAAACTGAA
AACACAGAAACTGTGGATAGTGGAATGAGTAATGGCATGGTGTGTGCATCTGGAGACCGG
AGTCATTACAGTGATTCTCAGCTCTCTTTACATGAGGATCTTTCTCCATGGAAGGAATGG
AATCAAGGAGCTGATTTAGGCTTGGATTCATCCACCCAGGAAGGTTTTGATTATGAAACA
AACAGTCTTTTTGACCAACAGCTTGATGTTTACAATAAAGACCTAGAATACTTGGGAAAG
TGCCACAGTGATCTTCAAGATGACTCAGAGAGCTACGACTTAACTCAAGATGACAATTCT
TCTCCATGCCCTGGCTTGGATAATGAACCACAAGGCCAGTGGGTTGGCCAATATGATTCT
TATCAGGGAGCTAATTCTAATGAGCTATACCAAAATCAAAACCAGTTGTCCATGATGTAT
CGAAGTCAAAGTGAATTGCAAAGTGATGATTCAGAGGATGCCCCACCCAAATCATGGCAT
AGTCGATTAAGCATTGACCTTTCTGATAAGACTTTCAGCTTCCCAAAATTTGGATCTACA
CTGCAGAGGGCTAAATCAGCCTTGGAAGTAGTATGGAACAAAAGCACACAGAGTCTGAGT
GGGTATGAGGACAGTGGCTCTTCATTAATGGGGAGATTTCGGACATTATCTCAATCAACT
GCAAATGAGTCAAGTACCACACTTGACTCTGATGTCTACACGGAGCCCTATTACTATAAA
GCAGAGGATGAGGAAGATTATACTGAACCAGTGGCTGACAATGAAACAGATTATGTTGAA
GTCATGGAACAAGTCCTTGCTAAACTAGAAAACAGGACTAGTATTACTGAAACAGATGAA
CAAATGCAAGCATATGATCACCTTTCATATGAAACACCTTATGAAACCCCACAAGATGAG
GGTTATGATGGTCCAGCAGATGATATGGTTAGTGAAGAGGGGTTAGAACCCTTAAATGAA
ACATCAGCTGAGATGGAAATAAGAGAAGATGAAAACCAAAACATTCCTGAACAGCCAGTG
GAGATCACAAAGCCAAAGAGAATTCGTCCTTCTTTCAAAGAAGCAGCTTTAAGGGCCTAT
AAAAAGCAAATGGCAGAGTTGGAAGAGAAGATCTTGGCTGGAGATAGCAGTTCTGTGGAT
GAAAAGGCTCGAATAGTAAGTGGCAATGATTTGGATGCTTCCAAATTTTCTGCACTCCAG
GTGTGTGGTGGGGCTGGAGGTGGACTTTATGGTATTGACAGCATGCCGGATCTTCGCAGA
AAAAAAACTTTGCCTATTGTCCGAGATGTGGCCATGACCCTGGCTGCCCGGAAATCTGGA
CTCTCCCTGGCTATGGTGATTAGGACATCCCTAAATAATGAGGAACTGAAAATGCACGTC
TTCAAGAAGACCTTGCAGGCACTGATCTACCCTATGTCTTCTACCATCCCACACAATTTT
GAGGTCTGGACGGCTACCACACCCACCTACTGTTATGAGTGTGAAGGGCTCCTGTGGGGC
ATTGCAAGGCAAGGCATGAAGTGTCTGGAGTGTGGAGTGAAATGCCACGAAAAGTGTCAG
GACCTGCTAAACGCTGACTGCTTGCAGAGAGCAGCAGAAAAGAGTTCTAAACATGGTGCC
GAAGACAAGACTCAGACCATTATTACAGCAATGAAAGAAAGAATGAAGATCAGGGAGAAA
AACCGGCCAGAAGTATTTGAAGTAATCCAGGAAATGTTTCAGATTTCTAAAGAAGATTTT
GTGCAGTTTACAAAGGCGGCCAAACAGAGTGTACTGGATGGGACATCTAAGTGGTCTGCA
AAAATAACCATTACAGTGGTTTCTGCACAGGGTCTACAGGCAAAAGATAAAACAGGGTCT
AGTGATCCATATGTTACAGTTCAAGTTGGAAAGAACAAAAGAAGAACAAAAACCATTTTT
GGAAATTTGAATCCAGTATGGGATGAGAAGTTTTATTTTGAGTGTCATAACTCCACAGAT
CGAATCAAAGTCAGAGTATGGGATGAAGATGATGATATTAAATCCAGAGTCAAGCAACAT
TTCAAAAAGGAGTCAGATGATTTTCTGGGACAAACAATTGTAGAAGTGAGGACCTTGAGT
GGAGAAATGGATGTCTGGTACAACTTAGAGAAAAGGACAGATAAGTCAGCTGTATCTGGG
GCCATACGATTGAAAATCAATGTGGAGATAAAAGGAGAAGAGAAGGTTGCTCCATATCAT
ATTCAATATACATGTTTACATGAGAATCTGTTCCATTACTTGACTGAAGTGAAATCTAAT
GGTGGAGTGAAAATCCCAGAAGTCAAAGGGGATGAAGCCTGGAAGGTTTTCTTTGATGAT
GCTTCCCAAGAAATAGTTGATGAATTTGCTATGCGTTATGGAATTGAATCCATTTATCAA
GCTATGACGCACTTTTCATGTCTGTCTTCTAAATACATGTGCCCCGGTGTCCCTGCCGTC
ATGAGCACCTTGCTGGCTAATATAAATGCTTTTTATGCTCACACAACAGTTTCAACAAAC
ATACAGGTTTCTGCCTCAGATCGATTTGCTGCTACCAACTTTGGTAGGGAAAAATTCATA
AAACTACTGGACCAGTTACATAACTCTTTGAGGATTGATCTGTCAAAGTATAGGGAAAAC
TTTCCTGCAAGCAATACTGAAAGACTGCAAGACCTGAAATCAACTGTTGACCTGTTAACA
AGTATCACCTTTTTTAGGATGAAGGTTCTGGAGCTGCAAAGCCCCCCAAAAGCGAGCATG
GTGGTGAAGGACTGTGTAAGGGCTTGCCTGGATTCTACATACAAGTATATTTTTGACAAC
TGCCATGAACTCTACTCCCAGCTAACAGACCCGAGTAAGAAACAGGATATTCCTCGTGAA
GATCAGGGACCAACCACCAAGAATTTGGATTTTTGGCCCCAACTTATTACACTGATGGTT
ACTATTATTGATGAGGATAAAACTGCCTACACACCTGTCCTGAATCAGTTTCCTCAAGAG
CTGAACATGGGAAAAATAAGTGCCGAAATTATGTGGACTCTTTTTGCTCTGGATATGAAA
TATGCATTAGAAGAACATGAAAATCAGCGGTTATGCAAGAGCACCGATTATATGAATTTG
CATTTCAAAGTTAAATGGTTTTATAATGAATATGTGCGTGAACTTCCTGCCTTCAAGGAT
GCTGTTCCTGAATACTCCTTGTGGTTTGAACCTTTTGTCATGCAATGGCTAGATGAAAAC
GAAGATGTGTCAATGGAATTCCTTCATGGAGCACTGGGAAGAGACAAAAAAGATGGATTC
CAGCAGACATCTGAGCATGCTCTCTTTTCTTGCTCCGTGGTTGATGTCTTTGCTCAGCTG
AATCAGAGCTTTGAAATTATTAAGAAACTGGAATGCCCTAATCCTGAAGCATTATCTCAC
TTAATGAGAAGATTTGCAAAGACTATCAATAAAGTGCTGCTCCAGTATGCTGCAATTGTA
TCAAGTGATTTCAGTTCACATTGTGATAAGGAAAATGTGCCCTGTATCTTGATGAACAAT
ATTCAACAATTGCGGGTCCAGCTGGAAAAAATGTTTGAATCCATGGGAGGGAAGGAGCTA
GATTCTGAAGCTAGTACTATTCTAAAAGAACTTCAGGTTAAGCTCAGTGGGGTCCTGGAT
GAGCTCAGCGTCACTTATGGTGAAAGTTTCCAGGTTATAATTGAAGAGTGTATAAAACAG
ATGAGTTTCGAACTAAATCAAATGAGAGCAAATGGAAACACCACATCTAATAAGAACAGT
GCAGCAATGGATGCAGAGATTGTGTTAAGATCTCTTATGGATTTTTTGGACAAAACATTA
AGTCTCTCAGCAAAAATCTGTGAGAAAACAGTCCTAAAGCGAGTTTTAAAAGAGTTATGG
AAGCTAGTTCTCAACAAAATAGAAAAACAAATTGTTCTTCCTCCTCTGACAGATCAAACA
GGACCCCAGATGATTTTCATTGCAGCTAAAGATCTTGGACAATTATCCAAACTGAAGGAG
CACATGATTCGAGAGGATGCCAGGGGTCTGACGCCAAGACAATGCGCTATAATGGAGGTA
GTCCTGGCTACCATCAAGCAATACTTTCATGCAGGAGGAAATGGCCTGAAAAAGAATTTC
TTGGAGAAAAGCCCAGATCTTCAGTCTCTGAGATATGCTCTCAGTCTTTATACCCAAACT
ACTGATGCCTTGATAAAGAAATTCATAGATACTCAAACCTCACAGAGTCGTTCCTCCAAA
GATGCCGTGGGTCAGATATCTGTTCATGTGGACATCACTGCCACCCCAGGAACGGGAGAT
CATAAAGTCACTGTAAAAGTGATTGCTATTAATGACCTAAACTGGCAGACCACAGCAATG
TTCCGCCCCTTTGTGGAAGTTTGTATACTGGGACCCAACCTTGGAGACAAGAAGAGAAAA
CAAGGCACAAAAACAAAAAGCAACACATGGTCACCAAAGTACAATGAAACATTTCAGTTC
ATTCTCGGAAAGGAAAATCGACCAGGGGCTTATGAACTTCATCTCTCAGTTAAGGATTAC
TGCTTTGCCAGAGAAGATCGAATTATCGGAATGACAGTCATTCAGCTACAGAACATAGCA
GAAAAGGGAAGCTATGGGGCATGGTATCCTCTTCTGAAAAATATCTCTATGGATGAAACT
GGTTTGACTATCCTTAGAATACTCTCTCAGAGGACCAGTGATGATGTGGCTAAAGAATTT
GTAAGACTTAAATCTGAAACAAGATCTACTGAAGAGAGTGCTTGA
Protein Properties
Number of Residues 2214
Molecular Weight 250909.3
Theoretical pI 5.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Protein unc-13 homolog C
MVANFFKSLILPYIHKLCKGMFTKKLGNTNKNKEYRQQKKDQDFPTAGQTKSPKFSYTFK
STVKKIAKCSSTHNLSTEEDEASKEFSLSPTFSYRVAIANGLQKNAKVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHGLKLGA
LRKLRKWKKSQECVSSDSELSTMKKSWGIRSKSLDRTVRNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVTEERFEYVESVVYQILIDKMGFSDAPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKEKG
IPSSQTYESMAIKLSTPEPKIKKNNWQSPDDSDEDLESDLNRNSYAVLSKSELLTKGSTS
KPSSKSHSARSKNKTANSSRISNKSDYDKISSQLPESDILEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PKDQHLNGGVQGIQGQTETENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQGADLGLDSSTQEGFDYETNSLFDQQLDVYNKDLEYLGKCHSDLQDDSESYDLTQDDNS
SPCPGLDNEPQGQWVGQYDSYQGANSNELYQNQNQLSMMYRSQSELQSDDSEDAPPKSWH
SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLSQST
ANESSTTLDSDVYTEPYYYKAEDEEDYTEPVADNETDYVEVMEQVLAKLENRTSITETDE
QMQAYDHLSYETPYETPQDEGYDGPADDMVSEEGLEPLNETSAEMEIREDENQNIPEQPV
EITKPKRIRPSFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQ
VCGGAGGGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHV
FKKTLQALIYPMSSTIPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQ
DLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISKEDF
VQFTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIF
GNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLS
GEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSN
GGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGVPAV
MSTLLANINAFYAHTTVSTNIQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYREN
FPASNTERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYIFDN
CHELYSQLTDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQE
LNMGKISAEIMWTLFALDMKYALEEHENQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKD
AVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSEHALFSCSVVDVFAQL
NQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSHCDKENVPCILMNN
IQQLRVQLEKMFESMGGKELDSEASTILKELQVKLSGVLDELSVTYGESFQVIIEECIKQ
MSFELNQMRANGNTTSNKNSAAMDAEIVLRSLMDFLDKTLSLSAKICEKTVLKRVLKELW
KLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDARGLTPRQCAIMEV
VLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSRSSK
DAVGQISVHVDITATPGTGDHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDKKRK
QGTKTKSNTWSPKYNETFQFILGKENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIA
EKGSYGAWYPLLKNISMDETGLTILRILSQRTSDDVAKEFVRLKSETRSTEESA
GenBank ID Protein 122937514
UniProtKB/Swiss-Prot ID Q8NB66
UniProtKB/Swiss-Prot Entry Name UN13C_HUMAN
PDB IDs
GenBank Gene ID NM_001080534.1
GeneCard ID UNC13C
GenAtlas ID UNC13C
HGNC ID HGNC:23149
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  4. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  5. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]