You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08102
Secondary Accession Numbers
  • 13813
Name Chemokine XC receptor 1
Synonyms
  1. G-protein coupled receptor 5
  2. Lymphotactin receptor
  3. XC chemokine receptor 1
Gene Name XCR1
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function Receptor for chemokines SCYC1 and SCYC2. Subsequently transduces a signal by increasing the intracellular calcium ions level
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
g-protein chemoattractant receptor activity
chemokine receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3p21.3-p21.1|3p21.3
SNPs XCR1
Gene Sequence
>1002 bp
ATGGAGTCCTCAGGCAACCCAGAGAGCACCACCTTTTTTTACTATGACCTTCAGAGCCAG
CCGTGTGAGAACCAGGCCTGGGTCTTTGCTACCCTCGCCACCACTGTCCTATACTGCCTG
GTGTTTCTCCTCAGCCTAGTGGGCAACAGCCTGGTCCTGTGGGTCCTGGTGAAGTATGAG
AGCCTGGAGTCCCTCACCAACATCTTCATCCTCAACCTGTGCCTCTCAGACCTGGTGTTC
GCCTGCTTGTTGCCTGTGTGGATCTCCCCATACCACTGGGGCTGGGTGCTGGGAGACTTC
CTCTGCAAACTCCTCAATATGATCTTCTCCATCAGCCTCTACAGCAGCATCTTCTTCCTG
ACCATCATGACCATCCACCGCTACCTGTCGGTAGTGAGCCCCCTCTCCACCCTGCGCGTC
CCCACCCTCCGCTGCCGGGTGCTGGTGACCATGGCTGTGTGGGTAGCCAGCATCCTGTCC
TCCATCCTCGACACCATCTTCCACAAGGTGCTTTCTTCGGGCTGTGATTATTCCGAACTC
ACGTGGTACCTCACCTCCGTCTACCAGCACAACCTCTTCTTCCTGCTGTCCCTGGGGATT
ATCCTGTTCTGCTACGTGGAGATCCTCAGGACCCTGTTCCGCTCACGCTCCAAGCGGCGC
CACCGCACGGTCAAGCTCATCTTCGCCATCGTGGTGGCCTACTTCCTCAGCTGGGGTCCC
TACAACTTCACCCTGTTTCTGCAGACGCTGTTTCGGACCCAGATCATCCGGAGCTGCGAG
GCCAAACAGCAGCTAGAATACGCCCTGCTCATCTGCCGCAACCTCGCCTTCTCCCACTGC
TGCTTTAACCCGGTGCTCTATGTCTTCGTGGGGGTCAAGTTCCGCACACACCTGAAACAT
GTTCTCCGGCAGTTCTGGTTCTGCCGGCTGCAGGCACCCAGCCCAGCCTCGATCCCCCAC
TCCCCTGGTGCCTTCGCCTATGAGGGCGCCTCCTTCTACTGA
Protein Properties
Number of Residues 333
Molecular Weight 38507.0
Theoretical pI 8.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 32-59
  • 70-89
  • 104-125
  • 143-167
  • 191-209
  • 226-250
  • 268-291
Protein Sequence
>Chemokine XC receptor 1
MESSGNPESTTFFYYDLQSQPCENQAWVFATLATTVLYCLVFLLSLVGNSLVLWVLVKYE
SLESLTNIFILNLCLSDLVFACLLPVWISPYHWGWVLGDFLCKLLNMIFSISLYSSIFFL
TIMTIHRYLSVVSPLSTLRVPTLRCRVLVTMAVWVASILSSILDTIFHKVLSSGCDYSEL
TWYLTSVYQHNLFFLLSLGIILFCYVEILRTLFRSRSKRRHRTVKLIFAIVVAYFLSWGP
YNFTLFLQTLFRTQIIRSCEAKQQLEYALLICRNLAFSHCCFNPVLYVFVGVKFRTHLKH
VLRQFWFCRLQAPSPASIPHSPGAFAYEGASFY
GenBank ID Protein 30526192
UniProtKB/Swiss-Prot ID P46094
UniProtKB/Swiss-Prot Entry Name XCR1_HUMAN
PDB IDs Not Available
GenBank Gene ID AY275469
GeneCard ID XCR1
GenAtlas ID XCR1
HGNC ID HGNC:1625
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Heiber M, Docherty JM, Shah G, Nguyen T, Cheng R, Heng HH, Marchese A, Tsui LC, Shi X, George SR, et al.: Isolation of three novel human genes encoding G protein-coupled receptors. DNA Cell Biol. 1995 Jan;14(1):25-35. [PubMed:7832990 ]
  3. Yoshida T, Imai T, Kakizaki M, Nishimura M, Takagi S, Yoshie O: Identification of single C motif-1/lymphotactin receptor XCR1. J Biol Chem. 1998 Jun 26;273(26):16551-4. [PubMed:9632725 ]