Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08103
Secondary Accession Numbers
  • 13814
Name Protein Z-dependent protease inhibitor
Synonyms
  1. PZ-dependent protease inhibitor
  2. PZI
  3. Serpin A10
Gene Name SERPINA10
Protein Type Unknown
Biological Properties
General Function Involved in serine-type endopeptidase inhibitor activity
Specific Function Inhibits factor Xa activity in the presence of protein Z, calcium and phospholipid
Pathways Not Available
Reactions Not Available
GO Classification
Function
peptidase inhibitor activity
endopeptidase inhibitor activity
serine-type endopeptidase inhibitor activity
enzyme regulator activity
enzyme inhibitor activity
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 14q32.13
SNPs SERPINA10
Gene Sequence
>1335 bp
ATGAAGGTGGTGCCAAGTCTCCTGCTCTCCGTCCTCCTGGCACAGGTGTGGCTGGTACCC
GGCTTGGCCCCCAGTCCTCAGTCGCCAGAGACCCCAGCCCCTCAGAACCAGACCAGCAGG
GTAGTGCAGGCTCCCAAGGAGGAAGAGGAAGATGAGCAGGAGGCCAGCGAGGAGAAGGCC
AGTGAGGAAGAGAAAGCCTGGCTGATGGCCAGCAGGCAGCAGCTTGCCAAGGAGACTTCA
AACTTCGGATTCAGCCTGCTGCGAAAGATCTCCATGAGGCACGATGGCAACATGGTCTTC
TCTCCATTTGGCATGTCCTTGGCCATGACAGGCTTGATGCTGGGGGCCACAGGGCCGACT
GAAACCCAGATCAAGAGAGGGCTCCACTTGCAGGCCCTGAAGCCCACCAAGCCCGGGCTC
CTGCCTTCCCTCTTTAAGGGACTCAGAGAGACCCTCTCCCGCAACCTGGAACTGGGCCTC
ACACAGGGGAGTTTTGCCTTCATCCACAAGGATTTTGATGTCAAAGAGACTTTCTTCAAT
TTATCCAAGAGGTATTTTGATACAGAGTGCGTGCCTATGAATTTTCGCAATGCCTCACAG
GCCAAAAGGCTCATGAATCATTACATTAACAAAGAGACTCGGGGGAAAATTCCCAAACTG
TTTGATGAGATTAATCCTGAAACCAAATTAATTCTTGTGGATTACATCTTGTTCAAAGGG
AAATGGTTGACCCCATTTGACCCTGTCTTCACCGAAGTCGACACTTTCCACCTGGACAAG
TACAAGACCATTAAGGTGCCCATGATGTACGGTGCAGGCAAGTTTGCCTCCACCTTTGAC
AAGAATTTTCGTTGTCATGTCCTCAAACTGCCCTACCAAGGAAATGCCACCATGCTGGTG
GTCCTCATGGAGAAAATGGGTGACCACCTCGCCCTTGAAGACTACCTGACCACAGACTTG
GTGGAGACATGGCTCAGAAACATGAAAACCAGAAACATGGAAGTTTTCTTTCCGAAGTTC
AAGCTAGATCAGAAGTATGAGATGCATGAGCTGCTTAGGCAGATGGGAATCAGAAGAATC
TTCTCACCCTTTGCTGACCTTAGTGAACTCTCAGCTACTGGAAGAAATCTCCAAGTATCC
AGGGTTTTACAAAGAACAGTGATTGAAGTTGATGAAAGGGGCACTGAGGCAGTGGCAGGA
ATCTTGTCAGAAATTACTGCTTATTCCATGCCTCCTGTCATCAAAGTGGACCGGCCATTT
CATTTCATGATCTATGAAGAAACCTCTGGAATGCTTCTGTTTCTGGGCAGGGTGGTGAAT
CCGACTCTCCTATAA
Protein Properties
Number of Residues 444
Molecular Weight 50706.6
Theoretical pI 8.58
Pfam Domain Function
Signals
  • 1-21
Transmembrane Regions
  • None
Protein Sequence
>Protein Z-dependent protease inhibitor
MKVVPSLLLSVLLAQVWLVPGLAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKA
SEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPT
ETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFN
LSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKG
KWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLV
VLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRI
FSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPF
HFMIYEETSGMLLFLGRVVNPTLL
GenBank ID Protein 5834412
UniProtKB/Swiss-Prot ID Q9UK55
UniProtKB/Swiss-Prot Entry Name ZPI_HUMAN
PDB IDs Not Available
GenBank Gene ID AF181467
GeneCard ID SERPINA10
GenAtlas ID SERPINA10
HGNC ID HGNC:15996
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  5. Zhou W, Ross MM, Tessitore A, Ornstein D, Vanmeter A, Liotta LA, Petricoin EF 3rd: An initial characterization of the serum phosphoproteome. J Proteome Res. 2009 Dec;8(12):5523-31. doi: 10.1021/pr900603n. [PubMed:19824718 ]
  6. Han X, Huang ZF, Fiehler R, Broze GJ Jr: The protein Z-dependent protease inhibitor is a serpin. Biochemistry. 1999 Aug 24;38(34):11073-8. [PubMed:10460162 ]
  7. Han X, Fiehler R, Broze GJ Jr: Isolation of a protein Z-dependent plasma protease inhibitor. Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9250-5. [PubMed:9689066 ]
  8. Han X, Fiehler R, Broze GJ Jr: Characterization of the protein Z-dependent protease inhibitor. Blood. 2000 Nov 1;96(9):3049-55. [PubMed:11049983 ]