You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08105
Secondary Accession Numbers
  • 13816
Name ADM2
Synonyms
  1. AM2
  2. Adrenomedullin-2
  3. IMDL
  4. IMDS
  5. Intermedin
  6. Intermedin-long
  7. Intermedin-short
Gene Name ADM2
Protein Type Unknown
Biological Properties
General Function Involved in hormone activity
Specific Function IMDL and IMDS may play a role as physiological regulators of gastrointestinal, cardiovascular bioactivities mediated by the CALCRL/RAMPs receptor complexes. Activates the cAMP-dependent pathway
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
binding
protein binding
receptor binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:2
Locus 22q13.33
SNPs ADM2
Gene Sequence
>447 bp
ATGGCCCGGATCCCGACGGCCGCCCTGGGTTGCATCAGCCTCCTCTGCCTGCAGCTCCCT
GGCTCGCTGTCCCGCAGCCTGGGCGGGGACCCGCGACCCGTCAAACCCAGGGAGCCCCCA
GCCCGGAGCCCTTCCAGCAGCCTGCAGCCCAGGCACCCCGCACCCCGACCTGTGGTCTGG
AAGCTTCACCGGGCCCTCCAGGCACAGAGGGGTGCCGGCCTGGCCCCTGTTATGGGTCAG
CCTCTCCGGGATGGTGGCCGCCAACACTCGGGCCCCCGAAGACACTCGGGCCCCCGCAGG
ACCCAAGCCCAGCTCCTGCGAGTGGGCTGTGTGCTGGGCACCTGCCAGGTGCAGAATCTC
AGCCACCGCCTGTGGCAACTCATGGGACCGGCCGGCCGGCAGGACTCAGCTCCTGTGGAC
CCCAGCAGCCCCCACAGCTATGGCTGA
Protein Properties
Number of Residues 148
Molecular Weight 15865.2
Theoretical pI 12.31
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • None
Protein Sequence
>ADM2
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW
KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL
SHRLWQLMGPAGRQDSAPVDPSSPHSYG
GenBank ID Protein 41016726
UniProtKB/Swiss-Prot ID Q7Z4H4
UniProtKB/Swiss-Prot Entry Name ADM2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB121034
GeneCard ID ADM2
GenAtlas ID ADM2
HGNC ID HGNC:28898
References
General References
  1. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  2. Roh J, Chang CL, Bhalla A, Klein C, Hsu SY: Intermedin is a calcitonin/calcitonin gene-related peptide family peptide acting through the calcitonin receptor-like receptor/receptor activity-modifying protein receptor complexes. J Biol Chem. 2004 Feb 20;279(8):7264-74. Epub 2003 Nov 13. [PubMed:14615490 ]
  3. Takei Y, Inoue K, Ogoshi M, Kawahara T, Bannai H, Miyano S: Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator. FEBS Lett. 2004 Jan 2;556(1-3):53-8. [PubMed:14706825 ]
  4. Takahashi K, Kikuchi K, Maruyama Y, Urabe T, Nakajima K, Sasano H, Imai Y, Murakami O, Totsune K: Immunocytochemical localization of adrenomedullin 2/intermedin-like immunoreactivity in human hypothalamus, heart and kidney. Peptides. 2006 Jun;27(6):1383-9. Epub 2005 Dec 15. [PubMed:16359754 ]