Hmdb loader
Identification
HMDB Protein ID HMDBP08110
Secondary Accession Numbers
  • 13821
Name Agouti-signaling protein
Synonyms
  1. ASP
  2. Agouti switch protein
Gene Name ASIP
Protein Type Unknown
Biological Properties
General Function Involved in hormone-mediated signaling pathway
Specific Function Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment). In higher primates, agouti may affect the quality of hair pigmentation rather than its pattern of deposition. Could well play a role in neuroendocrine aspects of melanocortin action. May have some functional role in regulating the lipid metabolism with adipocytes
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Process
hormone-mediated signaling pathway
signaling
signaling pathway
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:2
Locus 20q11.2-q12
SNPs ASIP
Gene Sequence
>399 bp
ATGGATGTCACCCGCTTACTCCTGGCCACCCTGCTGGTCTTCCTCTGCTTCTTCACTGCC
AACAGCCACCTGCCACCTGAGGAGAAGCTCCGAGATGACAGGAGCCTGAGAAGCAACTCC
TCTGTGAACCTACTGGATGTCCCTTCTGTCTCTATTGTGGCGCTGAACAAGAAATCCAAA
CAGATCGGCAGAAAAGCAGCAGAAAAGAAAAGATCTTCTAAGAAGGAGGCTTCGATGAAG
AAAGTGGTGCGGCCCCGGACCCCCCTATCTGCGCCCTGCGTGGCCACCCGCAACAGCTGC
AAGCCGCCGGCACCCGCCTGCTGCGACCCGTGCGCCTCCTGCCAGTGCCGCTTCTTCCGC
AGCGCCTGCTCCTGCCGCGTGCTCAGCCTCAACTGCTGA
Protein Properties
Number of Residues 132
Molecular Weight 14514.9
Theoretical pI 10.34
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • None
Protein Sequence
>Agouti-signaling protein
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSK
QIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFR
SACSCRVLSLNC
GenBank ID Protein 8953446
UniProtKB/Swiss-Prot ID P42127
UniProtKB/Swiss-Prot Entry Name ASIP_HUMAN
PDB IDs
GenBank Gene ID AL035458
GeneCard ID ASIP
GenAtlas ID ASIP
HGNC ID HGNC:745
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Kwon HY, Bultman SJ, Loffler C, Chen WJ, Furdon PJ, Powell JG, Usala AL, Wilkison W, Hansmann I, Woychik RP: Molecular structure and chromosomal mapping of the human homolog of the agouti gene. Proc Natl Acad Sci U S A. 1994 Oct 11;91(21):9760-4. [PubMed:7937887 ]
  4. Wilson BD, Ollmann MM, Kang L, Stoffel M, Bell GI, Barsh GS: Structure and function of ASP, the human homolog of the mouse agouti gene. Hum Mol Genet. 1995 Feb;4(2):223-30. [PubMed:7757071 ]
  5. McNulty JC, Jackson PJ, Thompson DA, Chai B, Gantz I, Barsh GS, Dawson PE, Millhauser GL: Structures of the agouti signaling protein. J Mol Biol. 2005 Mar 4;346(4):1059-70. Epub 2005 Jan 25. [PubMed:15701517 ]
  6. Kanetsky PA, Swoyer J, Panossian S, Holmes R, Guerry D, Rebbeck TR: A polymorphism in the agouti signaling protein gene is associated with human pigmentation. Am J Hum Genet. 2002 Mar;70(3):770-5. Epub 2002 Feb 6. [PubMed:11833005 ]