You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08111
Secondary Accession Numbers
  • 13822
Name Cyclic AMP-dependent transcription factor ATF-1
Synonyms
  1. Activating transcription factor 1
  2. Protein TREB36
  3. cAMP-dependent transcription factor ATF-1
Gene Name ATF1
Protein Type Unknown
Biological Properties
General Function Involved in sequence-specific DNA binding transcription factor activity
Specific Function This protein binds the cAMP response element (CRE) (consensus:5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter genes
Pathways Not Available
Reactions Not Available
GO Classification
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
protein binding
nucleic acid binding
dna binding
protein dimerization activity
sequence-specific dna binding
sequence-specific dna binding transcription factor activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13
SNPs ATF1
Gene Sequence
>816 bp
ATGGAAGATTCCCACAAGAGTACCACGTCAGAGACAGCACCTCAACCTGGTTCAGCAGTT
CAGGGAGCTCACATTTCTCATATTGCTCAACAGGTATCATCTTTATCAGAAAGTGAGGAG
TCCCAGGACTCATCCGACAGCATAGGCTCCTCACAGAAAGCCCACGGGATCCTAGCACGG
CGCCCATCTTACAGAAAAATTTTGAAAGACTTATCTTCTGAAGATACACGGGGCAGAAAA
GGAGACGGAGAAAATTCTGGAGTTTCTGCTGCTGTCACTTCTATGTCTGTTCCAACTCCC
ATCTATCAGACTAGCAGCGGACAGTATATTGCCATTGCCCCAAATGGAGCCTTACAGTTG
GCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGC
AGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATA
CTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAG
ATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTG
ACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTA
ATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGC
CTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAA
ACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGA
Protein Properties
Number of Residues 271
Molecular Weight 29232.4
Theoretical pI 8.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Cyclic AMP-dependent transcription factor ATF-1
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKSV
GenBank ID Protein 20810445
UniProtKB/Swiss-Prot ID P18846
UniProtKB/Swiss-Prot Entry Name ATF1_HUMAN
PDB IDs Not Available
GenBank Gene ID BC029619
GeneCard ID ATF1
GenAtlas ID ATF1
HGNC ID HGNC:783
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Yoshimura T, Fujisawa J, Yoshida M: Multiple cDNA clones encoding nuclear proteins that bind to the tax-dependent enhancer of HTLV-1: all contain a leucine zipper structure and basic amino acid domain. EMBO J. 1990 Aug;9(8):2537-42. [PubMed:2196176 ]
  5. Hai TW, Liu F, Coukos WJ, Green MR: Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers. Genes Dev. 1989 Dec;3(12B):2083-90. [PubMed:2516827 ]
  6. Hallor KH, Mertens F, Jin Y, Meis-Kindblom JM, Kindblom LG, Behrendtz M, Kalen A, Mandahl N, Panagopoulos I: Fusion of the EWSR1 and ATF1 genes without expression of the MITF-M transcript in angiomatoid fibrous histiocytoma. Genes Chromosomes Cancer. 2005 Sep;44(1):97-102. [PubMed:15884099 ]
  7. Rehfuss RP, Walton KM, Loriaux MM, Goodman RH: The cAMP-regulated enhancer-binding protein ATF-1 activates transcription in response to cAMP-dependent protein kinase A. J Biol Chem. 1991 Oct 5;266(28):18431-4. [PubMed:1655749 ]
  8. Waters BL, Panagopoulos I, Allen EF: Genetic characterization of angiomatoid fibrous histiocytoma identifies fusion of the FUS and ATF-1 genes induced by a chromosomal translocation involving bands 12q13 and 16p11. Cancer Genet Cytogenet. 2000 Sep;121(2):109-16. [PubMed:11063792 ]
  9. Sun P, Lou L, Maurer RA: Regulation of activating transcription factor-1 and the cAMP response element-binding protein by Ca2+/calmodulin-dependent protein kinases type I, II, and IV. J Biol Chem. 1996 Feb 9;271(6):3066-73. [PubMed:8621702 ]