You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08118
Secondary Accession Numbers
  • 13829
Name Cyclic nucleotide-gated olfactory channel
Synonyms
  1. CNG channel alpha-2
  2. CNG-2
  3. CNG2
  4. Cyclic nucleotide-gated cation channel 2
  5. Cyclic nucleotide-gated channel alpha-2
Gene Name CNGA2
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Odorant signal transduction is probably mediated by a G- protein coupled cascade using cAMP as second messenger. The olfactory channel can be shown to be activated by cyclic nucleotides which leads to a depolarization of olfactory sensory neurons
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Process
establishment of localization
transport
transmembrane transport
ion transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs CNGA2
Gene Sequence
>1995 bp
ATGACCGAAAAAACCAATGGTGTGAAGAGCTCCCCAGCCAATAATCACAACCATCATGCA
CCTCCTGCCATCAAGGCCAATGGCAAAGATGACCACAGGACAAGCAGCAGGCCACACTCT
GCAGCTGACGATGACACCTCCTCAGAACTGCAGAGGCTGGCAGACGTGGATGCCCCACAG
CAGGGAAGGAGTGGCTTCCGCAGGATAGTTCGCCTGGTGGGGATCATCAGAGAATGGGCC
AACAAGAATTTCCGAGAGGAGGAACCTAGGCCTGACTCATTCCTCGAGCGTTTTCGTGGG
CCTGAACTCCAGACTGTGACCACACAGGAGGGGGATGGCAAAGGCGACAAGGATGGCGAG
GACAAAGGCACCAAGAAGAAATTTGAACTATTTGTCTTGGACCCAGCTGGGGATTGGTAC
TACTGCTGGCTATTTGTCATTGCCATGCCCGTCCTTTACAACTGGTGCCTGCTGGTGGCC
AGAGCCTGCTTCAGTGACCTACAGAAAGGCTACTACCTGGTGTGGCTGGTGCTGGATTAT
GTCTCAGATGTGGTCTACATTGCGGACCTCTTCATCCGATTGCGCACAGGTTTCCTGGAG
CAGGGGCTGCTGGTCAAAGATACCAAGAAACTGCGAGACAACTACATCCACACCCTGCAG
TTCAAGCTGGATGTGGCTTCCATCATCCCCACTGACCTGATCTATTTTGCTGTGGACATC
CACAGCCCTGAGGTGCGCTTCAACCGCCTGCTGCACTTTGCCCGCATGTTTGAGTTCTTT
GACCGGACAGAGACACGCACCAACTACCCTAACATCTTCCGCATCAGCAACCTTGTCCTC
TACATCTTGGTCATCATCCACTGGAATGCCTGCATCTATTATGCCATCTCCAAATCCATA
GGCTTTGGGGTCGACACCTGGGTTTACCCAAACATCACTGACCCTGAGTATGGCTACCTG
GCTAGGGAATACATCTATTGCCTTTACTGGTCCACACTGACTCTCACTACCATTGGGGAG
ACACCACCCCCTGTAAAGGATGAGGAGTACCTATTTGTCATCTTTGACTTCCTGATTGGC
GTCCTCATCTTTGCCACCATCGTGGGAAATGTGGGCTCCATGATCTCCAACATGAATGCC
ACCCGGGCAGAGTTCCAGGCTAAGATCGATGCCGTGAAACACTACATGCAGTTCCGAAAG
GTCAGCAAGGGGATGGAAGCCAAGGTCATTAGGTGGTTTGACTACTTGTGGACCAATAAG
AAGACAGTGGATGAGCGAGAAATTCTCAAGAATCTGCCAGCCAAGCTCAGGGCTGAGATA
GCCATCAATGTCCACTTGTCCACACTCAAGAAAGTGCGCATCTTCCATGATTGTGAGGCT
GGCCTGCTGGTAGAGCTGGTACTGAAACTCCGTCCTCAGGTCTTCAGTCCTGGGGATTAC
ATTTGCCGCAAAGGGGACATCGGCAAGGAGATGTACATCATTAAGGAGGGCAAACTGGCA
GTGGTGGCTGATGATGGTGTGACTCAGTATGCTCTGCTGTCGGCTGGAAGCTGCTTTGGC
GAGATCAGTATCCTTAACATTAAGGGCAGTAAAATGGGCAATCGACGCACAGCTAATATC
CGCAGCCTGGGCTACTCAGATCTCTTCTGCTTGTCCAAGGATGATCTTATGGAAGCTGTG
ACTGAGTACCCTGATGCCAAGAAAGTCCTAGAAGAGAGGGGTCGGGAGATCCTCATGAAG
GAGGGACTGCTGGATGAGAACGAAGTGGCAACCAGCATGGAGGTCGACGTGCAGGAGAAG
CTAGGGCAGCTGGAGACCAACATGGAAACCTTGTACACTCGCTTTGGCCGCCTGCTGGCT
GAGTACACGGGGGCCCAGCAGAAGCTCAAGCAGCGCATCACAGTTCTGGAAACCAAGATG
AAACAGAACAATGAAGATGACTACCTGTCTGATGGGATGAACAGCCCTGAGCTGGCTGCT
GCTGACGAGCCATAA
Protein Properties
Number of Residues 664
Molecular Weight 76047.5
Theoretical pI 6.14
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 139-159
  • 172-192
  • 225-245
  • 275-295
  • 351-371
  • 454-474
Protein Sequence
>Cyclic nucleotide-gated olfactory channel
MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQ
QGRSGFRRIVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGE
DKGTKKKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDI
HSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNK
KTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAA
ADEP
GenBank ID Protein 116496687
UniProtKB/Swiss-Prot ID Q16280
UniProtKB/Swiss-Prot Entry Name CNGA2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC126302
GeneCard ID CNGA2
GenAtlas ID CNGA2
HGNC ID HGNC:2149
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Distler M, Biel M, Flockerzi V, Hofmann F: Expression of cyclic nucleotide-gated cation channels in non-sensory tissues and cells. Neuropharmacology. 1994 Nov;33(11):1275-82. [PubMed:7532814 ]