You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08124
Secondary Accession Numbers
  • 13835
Name CREB-regulated transcription coactivator 3
Synonyms
  1. TORC-3
  2. Transducer of CREB protein 3
  3. Transducer of regulated cAMP response element-binding protein 3
Gene Name CRTC3
Protein Type Unknown
Biological Properties
General Function Involved in interspecies interaction between organisms
Specific Function Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR)
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:1
Locus 15q26.1
SNPs CRTC3
Gene Sequence
>1860 bp
ATGGCCGCCTCGCCGGGCTCGGGCAGCGCCAACCCGCGGAAGTTCAGTGAGAAGATCGCG
CTGCACACGCAGAGACAGGCCGAGGAGACGCGGGCCTTCGAGCAGCTCATGACCGACCTC
ACCCTGTCGCGGGTTCAATTTCAGAAGCTTCAGCAACTGCGCCTTACACAGTACCATGGA
GGATCCTTACCAAATGTGAGCCAGCTGCGGAGCAGTGCGTCAGAGTTTCAGCCGTCATTT
CACCAAGCTGATAATGTTCGGGGAACCCGCCATCACGGGCTGGTGGAGAGGCCATCCAGG
AACCGCTTCCACCCCCTCCACCGAAGGTCTGGGGACAAGCCAGGGCGACAATTTGATGGT
AGTGCTTTTGGAGCCAATTATTCCTCACAGCCTCTGGATGAGAGTTGGCCAAGGCAGCAG
CCTCCTTGGAAAGACGAAAAGCATCCTGGGTTCAGGCTGACATCTGCACTTAACAGGACC
AATTCTGATTCTGCTCTTCACACGAGTGCTCTGAGTACCAAGCCCCAGGACCCCTATGGA
GGAGGGGGCCAGTCGGCCTGGCCTGCCCCATACATGGGTTTCTGTGATGGTGAGAATAAT
GGACATGGGGAAGTAGCATCTTTCCCTGGCCCATTGAAAGAAGAGAATCTGTTAAATGTT
CCGAAGCCACTGCCAAAACAACTGTGGGAGACCAAGGAGATTCAGTCCCTGTCAGGACGC
CCTCGATCCTGTGATGTTGGAGGTGGCAATGCTTTTCCACATAATGGTCAAAACCTAGGC
CTCTCACCCTTCTTGGGGACCTTGAACACTGGAGGGTCATTGCCAGATCTAACCAACCTC
CACTACTCGACACCCCTGCCAGCCTCCCTGGACACCACCGACCACCACTTTGGCAGTATG
AGTGTGGGGAATAGTGTGAACAACATCCCAGCTGCTATGACCCACCTGGGTATAAGAAGC
TCCTCTGGTCTCCAGAGTTCTCGGAGTAACCCCTCCATCCAAGCCACGCTCAATAAGACT
GTGCTTTCCTCTTCCTTAAATAACCACCCACAGACATCTGTTCCCAACGCATCTGCTCTT
CACCCTTCGCTCCGTCTGTTTTCCCTTAGCAACCCATCTCTTTCCACCACAAACCTGAGC
GGCCCGTCTCGGCGTCGGCAGCCTCCCGTCAGCCCTCTCACGCTTTCTCCTGGCCCTGAA
GCACATCAAGGTTTCAGCAGACAGCTGTCTTCAACCAGCCCACTGGCCCCATATCCTACC
TCCCAGATGGTGTCCTCAGACCGAAGCCAACTTTCCTTTCTGCCCACAGAAGCTCAAGCC
CAGGTGTCGCCGCCACCCCCTTACCCTGCACCCCAGGAGCTCACCCAGCCCCTCCTGCAG
CAGCCCCGCGCCCCTGAGGCCCCTGCCCAGCAGCCCCAGGCAGCCTCCTCACTGCCACAG
TCAGACTTTCAGCTTCTCCCGGCCCAGGGCTCATCTTTGACCAACTTCTTCCCAGATGTG
GGTTTTGACCAGCAGTCCATGAGGCCAGGCCCTGCCTTTCCTCAACAGGTGCCTCTGGTG
CAACAAGGTTCCCGAGAACTGCAGGACTCTTTTCATTTGAGACCAAGCCCGTATTCCAAC
TGCGGGAGTCTCCCGAACACCATCCTGCCAGAAGACTCCAGCACCAGCCTGTTCAAAGAC
CTCAACAGTGCGCTGGCAGGCCTGCCTGAGGTCAGCCTGAACGTGGACACTCCATTTCCA
CTGGAAGAGGAGCTGCAGATTGAACCCCTGAGCCTGGACGGACTCAACATGTTAAGTGAC
TCCAGCATGGGCCTGCTGGACCCCTCTGTTGAAGAGACGTTTCGAGCTGACAGACTGTGA
Protein Properties
Number of Residues 619
Molecular Weight 66958.7
Theoretical pI 6.83
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>CREB-regulated transcription coactivator 3
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHG
GSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDG
SAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYG
GGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGR
PRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSM
SVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASAL
HPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPT
SQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQ
SDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSN
CGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSD
SSMGLLDPSVEETFRADRL
GenBank ID Protein 110431354
UniProtKB/Swiss-Prot ID Q6UUV7
UniProtKB/Swiss-Prot Entry Name CRTC3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_022769.3
GeneCard ID CRTC3
GenAtlas ID CRTC3
HGNC ID HGNC:26148
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  8. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]
  9. Conkright MD, Canettieri G, Screaton R, Guzman E, Miraglia L, Hogenesch JB, Montminy M: TORCs: transducers of regulated CREB activity. Mol Cell. 2003 Aug;12(2):413-23. [PubMed:14536081 ]
  10. Iourgenko V, Zhang W, Mickanin C, Daly I, Jiang C, Hexham JM, Orth AP, Miraglia L, Meltzer J, Garza D, Chirn GW, McWhinnie E, Cohen D, Skelton J, Terry R, Yu Y, Bodian D, Buxton FP, Zhu J, Song C, Labow MA: Identification of a family of cAMP response element-binding protein coactivators by genome-scale functional analysis in mammalian cells. Proc Natl Acad Sci U S A. 2003 Oct 14;100(21):12147-52. Epub 2003 Sep 23. [PubMed:14506290 ]
  11. Screaton RA, Conkright MD, Katoh Y, Best JL, Canettieri G, Jeffries S, Guzman E, Niessen S, Yates JR 3rd, Takemori H, Okamoto M, Montminy M: The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector. Cell. 2004 Oct 1;119(1):61-74. [PubMed:15454081 ]
  12. Bittinger MA, McWhinnie E, Meltzer J, Iourgenko V, Latario B, Liu X, Chen CH, Song C, Garza D, Labow M: Activation of cAMP response element-mediated gene expression by regulated nuclear transport of TORC proteins. Curr Biol. 2004 Dec 14;14(23):2156-61. [PubMed:15589160 ]
  13. Katoh Y, Takemori H, Lin XZ, Tamura M, Muraoka M, Satoh T, Tsuchiya Y, Min L, Doi J, Miyauchi A, Witters LA, Nakamura H, Okamoto M: Silencing the constitutive active transcription factor CREB by the LKB1-SIK signaling cascade. FEBS J. 2006 Jun;273(12):2730-48. [PubMed:16817901 ]
  14. Siu YT, Chin KT, Siu KL, Yee Wai Choy E, Jeang KT, Jin DY: TORC1 and TORC2 coactivators are required for tax activation of the human T-cell leukemia virus type 1 long terminal repeats. J Virol. 2006 Jul;80(14):7052-9. [PubMed:16809310 ]
  15. Wu Z, Huang X, Feng Y, Handschin C, Feng Y, Gullicksen PS, Bare O, Labow M, Spiegelman B, Stevenson SC: Transducer of regulated CREB-binding proteins (TORCs) induce PGC-1alpha transcription and mitochondrial biogenesis in muscle cells. Proc Natl Acad Sci U S A. 2006 Sep 26;103(39):14379-84. Epub 2006 Sep 15. [PubMed:16980408 ]
  16. Takemori H, Kanematsu M, Kajimura J, Hatano O, Katoh Y, Lin XZ, Min L, Yamazaki T, Doi J, Okamoto M: Dephosphorylation of TORC initiates expression of the StAR gene. Mol Cell Endocrinol. 2007 Feb;265-266:196-204. Epub 2007 Jan 8. [PubMed:17210223 ]
  17. Koga H, Ohshima T, Shimotohno K: Enhanced activation of tax-dependent transcription of human T-cell leukemia virus type I (HTLV-I) long terminal repeat by TORC3. J Biol Chem. 2004 Dec 17;279(51):52978-83. Epub 2004 Oct 4. [PubMed:15466468 ]
  18. Hishiki T, Ohshima T, Ego T, Shimotohno K: BCL3 acts as a negative regulator of transcription from the human T-cell leukemia virus type 1 long terminal repeat through interactions with TORC3. J Biol Chem. 2007 Sep 28;282(39):28335-43. Epub 2007 Jul 20. [PubMed:17644518 ]