You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08127
Secondary Accession Numbers
  • 13838
Name FERM, RhoGEF and pleckstrin domain-containing protein 1
Synonyms
  1. Chondrocyte-derived ezrin-like protein
  2. PH domain-containing family C member 2
  3. Pleckstrin homology domain-containing family C member 2
Gene Name FARP1
Protein Type Unknown
Biological Properties
General Function Involved in Rho guanyl-nucleotide exchange factor activity
Specific Function May function as Rho-guanine nucleotide exchange factor
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
intracellular part
cytoplasm
cytoskeleton
membrane part
organelle
extrinsic to membrane
intracellular
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
small gtpase regulator activity
binding
ras guanyl-nucleotide exchange factor activity
rho guanyl-nucleotide exchange factor activity
enzyme regulator activity
protein binding
cytoskeletal protein binding
nucleoside-triphosphatase regulator activity
gtpase regulator activity
Process
regulation of ras protein signal transduction
regulation of rho protein signal transduction
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell communication
regulation of signal transduction
regulation of small gtpase mediated signal transduction
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 13q32.2
SNPs FARP1
Gene Sequence
>3138 bp
ATGGGAGAAATAGAGCAGAGGCCGACCCCAGGATCACGACTGGGGGCCCCGGAAAATTCG
GGGATCAGTACCTTGGAACGTGGACAGAAGCCGCCCCCAACACCTTCAGGAAAACTCGTG
TCCATCAAAATCCAGATGCTGGATGACACCCAGGAGGCATTTGAAGTTCCACAAAGAGCT
CCTGGGAAGGTGCTGCTGGATGCAGTTTGCAACCACCTCAACCTCGTGGAAGGTGACTAT
TTTGGCCTCGAGTTTCCTGATCACAAAAAGATCACGGTGTGGCTGGATCTCCTAAAACCC
ATTGTGAAACAGATTAGAAGGCCAAAGCACGTTGTTGTTAAGTTTGTGGTGAAATTCTTT
CCGCCTGACCACACACAACTCCAAGAAGAACTCACAAGGTACCTGTTCGCGCTGCAGGTG
AAGCAGGACTTGGCTCAAGGCAGGTTGACGTGTAATGACACCAGCGCAGCTCTCTTGATT
TCACACATTGTGCAATCTGAGATTGGGGATTTTGATGAAGCCTTGGACAGAGAGCACTTA
GCAAAAAATAAATACATACCTCAGCAAGACGCACTAGAGGACAAAATCGTGGAATTTCAC
CATAACCACATTGGACAAACACCAGCAGAATCAGATTTCCAGCTCCTAGAGATTGCCCGT
CGGCTAGAGATGTATGGAATCCGGTTGCACCCGGCCAAGGACAGGGAAGGCACGAAGATC
AATCTGGCCGTTGCCAACACGGGAATTCTAGTGTTTCAGGGTTTCACTAAGATCAATGCC
TTCAACTGGGCCAAGGTGCGGAAGCTGAGCTTCAAGAGGAAGCGCTTTCTCATCAAGCTC
CGGCCAGATGCCAATAGTGCGTACCAGGATACCTTGGAATTCCTGATGGCCAGTCGGGAT
TTCTGCAAGTCCTTCTGGAAAATCTGTGTTGAACATCATGCCTTCTTTAGACTTTTTGAA
GAGCCCAAACCAAAGCCCAAGCCCGTCCTCTTTAGCCGGGGGTCATCATTTCGGTTCAGT
GGTCGGACTCAGAAGCAGGTTCTCGACTATGTTAAAGAAGGAGGACATAAGAAGGTGCAG
TTTGAAAGGAAGCACAGCAAGATTCATTCTATCCGGAGCCTTGCTTCACAGCCTACAGAA
CTGAATTCGGAAGTGCTGGAGCAGTCTCAGCAGAGCACCAGCCTTACATTTGGAGAAGGT
GCCGAATCTCCAGGGGGCCAGAGCTGCCGGCGAGGAAAGGAACCGAAGGTTTCCGCCGGG
GAGCCGGGGTCGCACCCGAGCCCTGCGCCGAGGAGAAGCCCCGCGGGTAACAAGCAGGCG
GACGGAGCCGCCTCGGCGCCCACGGAGGAAGAGGAGGAGGTCGTTAAGGATAGGACCCAG
CAGAGTAAACCTCAGCCCCCGCAGCCAAGCACAGGCTCCCTGACTGGCAGTCCTCACCTT
TCCGAGCTGTCTGTGAACTCGCAGGGGGGAGTGGCCCCTGCCAACGTGACCTTGTCTCCC
AACCTGAGCCCCGACACCAAGCAGGCCTCTCCCTTGATCAGCCCGCTGCTGAATGACCAG
GCCTGCCCCCGGACGGACGATGAGGATGAGGGCCGGAGGAAGAGATTCCCAACTGATAAA
GCGTACTTCATAGCTAAGGAAGTGTCTACCACCGAGCGAACATATCTGAAGGATCTCGAA
GTTATCACTTCGTGGTTTCAGAGCACAGTGAGCAAAGAGGACGCCATGCCGGAAGCACTG
AAAAGTCTCATATTCCCGAATTTTGAACCTTTGCACAAATTTCATACTAATTTTCTCAAG
GAAATTGAGCAACGACTTGCCCTGTGGGAAGGCCGCTCAAATGCCCAAATCAGAGATTAC
CAAAGAATCGGCGATGTCATGCTGAAGAACATTCAGGGCATGAAGCACCTGGCGGCTCAC
CTGTGGAAGCACAGCGAGGCCTTGGAGGCCCTGGAGAATGGAATCAAGAGCTCCCGGCGG
CTGGAGAACTTCTGCAGAGACTTTGAGCTGCAGAAGGTGTGTTACCTACCGCTCAACACC
TTCCTCCTGCGGCCACTGCACCGGCTCATGCACTACAAGCAGGTCCTGGAGCGGCTGTGC
AAACACCACCCGCCGAGCCACGCCGACTTCAGGGACTGCCGAGCCGCTTTGGCAGAGATC
ACGGAGATGGTGGCACAGCTCCACGGTACGATGATCAAGATGGAGAATTTCCAGAAGCTG
CACGAACTCAAGAAAGATTTGATTGGCATTGACAATCTTGTGGTTCCGGGAAGGGAGTTC
ATCCGTCTGGGCAGCCTCAGCAAGCTCTCGGGGAAGGGGCTCCAGCAGCGCATGTTCTTC
CTGTTCAACGACGTCCTGCTATACACGAGCCGGGGGCTGACGGCCTCCAATCAGTTTAAA
GTCCACGGGCAGCTCCCGCTCTATGGCATGACGATTGAGGAGAGCGAAGACGAGTGGGGG
GTGCCCCACTGCCTGACCCTCCGGGGCCAGCGGCAGTCCATCATCGTGGCCGCCAGTTCT
CGGTCCGAGATGGAGAAGTGGGTTGAGGACATCCAGATGGCCATTGACCTGGCGGAGAAG
AGCAGCAGCCCCGCCCCTGAGTTCCTGGCCAGCAGCCCCCCTGACAACAAGTCCCCTGAT
GAAGCCACCGCGGCTGACCAGGAGTCAGAGGATGACCTGAGCGCCTCGCGCACATCGCTG
GAGCGCCAGGCCCCGCACCGCGGCAACACAATGGTGCACGTGTGCTGGCACCGCAACACC
AGCGTCTCCATGGTGGACTTCAGCATCGCAGTGGAGAATCAGTTGTCTGGAAACCTGCTG
AGGAAATTCAAAAACAGCAACGGGTGGCAGAAGCTGTGGGTGGTGTTCACAAACTTCTGC
CTGTTCTTCTACAAATCACACCAGGACAATCATCCCCTTGCCAGCCTGCCTCTGCTCGGC
TACTCGCTCACCATCCCCTCTGAGTCCGAGAACATCCAGAAAGACTACGTGTTCAAGCTG
CACTTCAAGTCCCACGTCTACTACTTCAGGGCGGAAAGCGAGTACACGTTCGAAAGGTGG
ATGGAAGTGATCCGCAGTGCCACCAGCTCTGCCTCGCGACCCCACGTGTTGAGCCACAAA
GAGTCTCTTGTGTATTGA
Protein Properties
Number of Residues 1045
Molecular Weight 118631.9
Theoretical pI 8.27
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>FERM, RhoGEF and pleckstrin domain-containing protein 1
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHL
SELSVNSQGGVAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDK
AYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLK
EIEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRR
LENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEI
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFF
LFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSL
ERQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFC
LFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERW
MEVIRSATSSASRPHVLSHKESLVY
GenBank ID Protein 2766165
UniProtKB/Swiss-Prot ID Q9Y4F1
UniProtKB/Swiss-Prot Entry Name FARP1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB008430
GeneCard ID FARP1
GenAtlas ID FARP1
HGNC ID HGNC:3591
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  5. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  8. Dunham A, Matthews LH, Burton J, Ashurst JL, Howe KL, Ashcroft KJ, Beare DM, Burford DC, Hunt SE, Griffiths-Jones S, Jones MC, Keenan SJ, Oliver K, Scott CE, Ainscough R, Almeida JP, Ambrose KD, Andrews DT, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Bannerjee R, Barlow KF, Bates K, Beasley H, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burrill W, Carder C, Carter NP, Chapman JC, Clamp ME, Clark SY, Clarke G, Clee CM, Clegg SC, Cobley V, Collins JE, Corby N, Coville GJ, Deloukas P, Dhami P, Dunham I, Dunn M, Earthrowl ME, Ellington AG, Faulkner L, Frankish AG, Frankland J, French L, Garner P, Garnett J, Gilbert JG, Gilson CJ, Ghori J, Grafham DV, Gribble SM, Griffiths C, Hall RE, Hammond S, Harley JL, Hart EA, Heath PD, Howden PJ, Huckle EJ, Hunt PJ, Hunt AR, Johnson C, Johnson D, Kay M, Kimberley AM, King A, Laird GK, Langford CJ, Lawlor S, Leongamornlert DA, Lloyd DM, Lloyd C, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, McLaren SJ, McMurray A, Milne S, Moore MJ, Nickerson T, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter KM, Rice CM, Searle S, Sehra HK, Shownkeen R, Skuce CD, Smith M, Steward CA, Sycamore N, Tester J, Thomas DW, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Wilming L, Wray PW, Wright MW, Young L, Coulson A, Durbin R, Hubbard T, Sulston JE, Beck S, Bentley DR, Rogers J, Ross MT: The DNA sequence and analysis of human chromosome 13. Nature. 2004 Apr 1;428(6982):522-8. [PubMed:15057823 ]
  9. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  10. Koyano Y, Kawamoto T, Shen M, Yan W, Noshiro M, Fujii K, Kato Y: Molecular cloning and characterization of CDEP, a novel human protein containing the ezrin-like domain of the band 4.1 superfamily and the Dbl homology domain of Rho guanine nucleotide exchange factors. Biochem Biophys Res Commun. 1997 Dec 18;241(2):369-75. [PubMed:9425278 ]