Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08129
Secondary Accession Numbers
  • 13840
Name Glycoprotein hormone alpha-2
Synonyms
  1. Putative secreted protein Zsig51
  2. Thyrostimulin subunit alpha
Gene Name GPHA2
Protein Type Unknown
Biological Properties
General Function Involved in hormone activity
Specific Function Stimulates the thyroid. Binds and activates THSR, leads to increased cAMP production
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region
Function
hormone activity
binding
protein binding
receptor binding
Cellular Location
  1. Secreted
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.1
SNPs GPHA2
Gene Sequence
>390 bp
ATGCCTATGGCGTCCCCTCAAACCCTGGTCCTCTATCTGCTGGTCCTGGCAGTCACTGAA
GCCTGGGGCCAGGAGGCAGTCATCCCAGGCTGCCACTTGCACCCCTTCAATGTGACAGTG
CGAAGTGACCGCCAAGGCACCTGCCAGGGCTCCCACGTGGCACAGGCCTGTGTGGGCCAC
TGTGAGTCCAGCGCCTTCCCTTCTCGGTACTCTGTGCTGGTGGCCAGTGGTTACCGACAC
AACATCACCTCCGTCTCTCAGTGCTGCACCATCAGTGGCCTGAAGAAGGTCAAAGTACAG
CTGCAGTGTGTGGGGAGCCGGAGGGAGGAGCTCGAGATCTTCACGGCCAGGGCCTGCCAG
TGTGACATGTGTCGCCTCTCTCGCTACTAG
Protein Properties
Number of Residues 129
Molecular Weight 14163.3
Theoretical pI 8.27
Pfam Domain Function Not Available
Signals
  • 1-23
Transmembrane Regions
  • None
Protein Sequence
>Glycoprotein hormone alpha-2
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGH
CESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQ
CDMCRLSRY
GenBank ID Protein 14009506
UniProtKB/Swiss-Prot ID Q96T91
UniProtKB/Swiss-Prot Entry Name GPHA2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF260739
GeneCard ID GPHA2
GenAtlas ID GPHA2
HGNC ID HGNC:18054
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nakabayashi K, Matsumi H, Bhalla A, Bae J, Mosselman S, Hsu SY, Hsueh AJ: Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor. J Clin Invest. 2002 Jun;109(11):1445-52. [PubMed:12045258 ]
  3. Hsu SY, Nakabayashi K, Bhalla A: Evolution of glycoprotein hormone subunit genes in bilateral metazoa: identification of two novel human glycoprotein hormone subunit family genes, GPA2 and GPB5. Mol Endocrinol. 2002 Jul;16(7):1538-51. [PubMed:12089349 ]