Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08137
Secondary Accession Numbers
  • 13848
Name cAMP-dependent protein kinase type I-beta regulatory subunit
Synonyms Not Available
Gene Name PRKAR1B
Protein Type Unknown
Biological Properties
General Function Involved in cAMP-dependent protein kinase regulator activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
macromolecular complex
protein complex
camp-dependent protein kinase complex
Function
enzyme regulator activity
kinase regulator activity
protein kinase regulator activity
camp-dependent protein kinase regulator activity
Process
regulation of cellular protein metabolic process
regulation of protein modification process
regulation of protein amino acid phosphorylation
biological regulation
regulation of biological process
regulation of metabolic process
regulation of cellular process
signal transduction
regulation of cellular metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22
SNPs PRKAR1B
Gene Sequence
>1146 bp
ATGGCCTCCCCGCCCGCCTGCCCCTCGGAGGAGGACGAGAGCCTGAAGGGCTGTGAGCTG
TACGTGCAGCTGCACGGGATCCAGCAGGTCCTCAAAGACTGTATCGTCCACCTCTGCATC
TCCAAGCCCGAACGCCCCATGAAGTTCCTCCGGGAGCACTTCGAGAAGCTGGAGAAGGAA
GAAAACAGGCAGATTTTGGCGCGGCAAAAGTCAAACTCACAGTCGGACTCCCATGATGAG
GAGGTGTCGCCCACCCCCCCGAACCCTGTGGTGAAGGCCCGCCGCCGGCGAGGAGGCGTG
AGTGCCGAGGTGTACACCGAGGAGGACGCCGTGTCCTACGTCAGGAAGGTGATTCCCAAG
GACTACAAAACCATGACTGCCCTGGCCAAGGCCATCTCCAAGAACGTGCTCTTCGCTCAC
CTGGATGACAACGAGAGGAGTGACATATTCGATGCCATGTTCCCTGTCACTCACATCGCT
GGGGAGACTGTTATACAGCAAGGGAATGAAGGAGACAACTTCTATGTCGTTGATCAAGGG
GAAGTGGATGTGTACGTGAACGGAGAGTGGGTGACCAACATCAGCGAGGGAGGCAGCTTC
GGGGAGCTGGCGCTCATCTACGGCACCCCCAGGGCTGCGACCGTGAAAGCCAAGACGGAC
CTCAAGCTCTGGGGGATCGACCGGGACAGCTACCGGCGCATCCTTATGGGCAGCACGCTG
AGGAAACGCAAGATGTACGAGGAGTTCCTCAGCAAGGTCTCCATCCTAGAGTCCCTGGAG
AAGTGGGAGCGTCTGACCGTGGCGGATGCGCTGGAGCCCGTCCAGTTTGAAGATGGAGAG
AAAATTGTGGTCCAGGGAGAGCCTGGGGACGACTTTTACATCATCACGGAGGGCACCGCG
TCCGTGCTGCAGCGCCGGTCCCCCAATGAGGAGTACGTGGAGGTGGGGCGCCTGGGACCC
TCTGACTACTTCGGGGAGATTGCACTGCTGCTGAACCGGCCCCGGGCGGCCACTGTCGTG
GCCCGGGGGCCCCTCAAGTGTGTGAAGCTGGACCGGCCCCGCTTCGAGCGTGTGCTGGGG
CCCTGCTCTGAGATCCTCAAGAGGAACATTCAGCGTTACAACAGCTTCATCTCCCTCACC
GTCTGA
Protein Properties
Number of Residues 381
Molecular Weight 43072.6
Theoretical pI 5.41
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>cAMP-dependent protein kinase type I-beta regulatory subunit
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
GenBank ID Protein 221045290
UniProtKB/Swiss-Prot ID P31321
UniProtKB/Swiss-Prot Entry Name KAP1_HUMAN
PDB IDs
GenBank Gene ID AK315951
GeneCard ID PRKAR1B
GenAtlas ID PRKAR1B
HGNC ID HGNC:9390
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Zhan X, Desiderio DM: Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry. Anal Biochem. 2006 Jul 15;354(2):279-89. Epub 2006 Jun 5. [PubMed:16777052 ]
  7. Solberg R, Tasken K, Keiserud A, Jahnsen T: Molecular cloning, cDNA structure and tissue-specific expression of the human regulatory subunit RI beta of cAMP-dependent protein kinases. Biochem Biophys Res Commun. 1991 Apr 15;176(1):166-72. [PubMed:1708242 ]
  8. Solberg R, Tasken K, Wen W, Coghlan VM, Meinkoth JL, Scott JD, Jahnsen T, Taylor SS: Human regulatory subunit RI beta of cAMP-dependent protein kinases: expression, holoenzyme formation and microinjection into living cells. Exp Cell Res. 1994 Oct;214(2):595-605. [PubMed:7925653 ]