Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08140
Secondary Accession Numbers
  • 13851
Name Potassium voltage-gated channel subfamily A member 10
Synonyms
  1. Voltage-gated potassium channel subunit Kv1.8
Gene Name KCNA10
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Mediates voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. The channel activity is up-regulated by cAMP
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
potassium channel complex
voltage-gated potassium channel complex
macromolecular complex
protein complex
Function
binding
protein binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1p13.1
SNPs KCNA10
Gene Sequence
>1536 bp
ATGGATGTGTGTGGCTGGAAAGAAATGGAGGTTGCGCTGGTCAATTTTGATAATTCAGAT
GAAATCCAAGAAGAGCCAGGCTATGCCACAGACTTCGACTCAACCAGCCCAAAAGGCCGG
CCTGGGGGCAGCTCCTTCTCCAACGGGAAGATCCTCATCAGCGAAAGCACCAACCATGAG
ACGGCCTTCTCCAAGCTTCCGGGAGACTATGCTGACCCCCCAGGGCCTGAGCCAGTGGTC
CTAAATGAAGGAAACCAGCGGGTGATCATCAACATTGCTGGGCTGAGATTTGAGACCCAG
CTCAGAACCCTTAGTCAGTTCCCAGAGACTCTCCTGGGAGACCGGGAGAAAAGGATGCAG
TTCTTTGACTCCATGAGAAATGAGTATTTCTTTGATCGTAACCGGCCCAGTTTTGATGGA
ATCCTATATTATTACCAATCTGGTGGGAAAATTCGGCGCCCAGCCAATGTTCCCATTGAT
ATCTTTGCTGATGAAATCTCCTTCTATGAGCTGGGTAGTGAGGCCATGGACCAGTTCCGG
GAGGATGAAGGCTTCATCAAAGACCCTGAAACACTGCTACCCACCAATGACATCCACCGT
CAGTTCTGGCTCCTCTTTGAGTACCCTGAAAGTTCCAGCGCTGCCCGTGCTGTGGCCGTG
GTCTCGGTGTTGGTTGTGGTCATCTCCATCACCATCTTCTGCCTGGAGACACTGCCAGAG
TTCCGGGAGGATAGGGAGCTGAAGGTGGTCAGAGACCCCAATCTCAACATGAGCAAGACA
GTCCTCTCCCAGACCATGTTCACCGACCCTTTCTTCATGGTGGAGTCTACCTGCATCGTG
TGGTTCACCTTCGAGCTGGTGCTCCGGTTCGTGGTCTGCCCCAGCAAGACTGACTTCTTC
AGGAACATCATGAACATCATTGACATCATCTCCATTATCCCCTACTTTGCAACTCTCATC
ACAGAGCTAGTCCAGGAGACAGAGCCGAGTGCCCAACAGAACATGTCCCTGGCCATCCTG
AGGATCATCCGCCTGGTGAGGGTCTTCCGCATCTTCAAGCTCTCGCGCCACTCCAAGGGG
CTGCAGATCCTCGGGCAAACACTGAAGGCGTCCATGCGGGAGTTGGGGTTGCTCATCTTC
TTTCTCTTCATTGGAGTCATCCTCTTCTCCAGTGCAGTCTACTTTGCTGAGGTGGATGAG
CCAGAGTCCCATTTCTCTAGCATTCCTGATGGCTTCTGGTGGGCAGTGGTCACCATGACA
ACTGTAGGCTATGGGGACATGTGCCCGACCACCCCAGGGGGGAAGATTGTGGGCACTCTG
TGTGCCATTGCAGGGGTCCTCACCATTGCCCTCCCTGTGCCTGTCATTGTCTCCAACTTC
AATTACTTCTACCACCGGGAGACTGAGAATGAAGAAAAGCAGAACATCCCGGGAGAAATT
GAAAGAATCCTCAACAGTGTAGGCTCAAGAATGGGCAGCACAGACTCTCTTAATAAGACC
AATGGTGGCTGTTCCACAGAGAAGTCTAGGAAATGA
Protein Properties
Number of Residues 511
Molecular Weight 57784.5
Theoretical pI 4.57
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 218-238
  • 271-292
  • 303-323
  • 339-358
  • 375-395
  • 436-456
Protein Sequence
>Potassium voltage-gated channel subfamily A member 10
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKILISESTNHE
TAFSKLPGDYADPPGPEPVVLNEGNQRVIINIAGLRFETQLRTLSQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETLLPTNDIHRQFWLLFEYPESSSAARAVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPNLNMSKTVLSQTMFTDPFFMVESTCIVWFTFELVLRFVVCPSKTDFF
RNIMNIIDIISIIPYFATLITELVQETEPSAQQNMSLAILRIIRLVRVFRIFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
ERILNSVGSRMGSTDSLNKTNGGCSTEKSRK
GenBank ID Protein 50959682
UniProtKB/Swiss-Prot ID Q16322
UniProtKB/Swiss-Prot Entry Name KCA10_HUMAN
PDB IDs Not Available
GenBank Gene ID BC074990
GeneCard ID KCNA10
GenAtlas ID KCNA10
HGNC ID HGNC:6219
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Orias M, Bray-Ward P, Curran ME, Keating MT, Desir GV: Genomic localization of the human gene for KCNA10, a cGMP-activated K channel. Genomics. 1997 May 15;42(1):33-7. [PubMed:9177773 ]
  5. Lang R, Lee G, Liu W, Tian S, Rafi H, Orias M, Segal AS, Desir GV: KCNA10: a novel ion channel functionally related to both voltage-gated potassium and CNG cation channels. Am J Physiol Renal Physiol. 2000 Jun;278(6):F1013-21. [PubMed:10836990 ]
  6. Tian S, Liu W, Wu Y, Rafi H, Segal AS, Desir GV: Regulation of the voltage-gated K+ channel KCNA10 by KCNA4B, a novel beta-subunit. Am J Physiol Renal Physiol. 2002 Jul;283(1):F142-9. [PubMed:12060596 ]
  7. Yao X, Tian S, Chan HY, Biemesderfer D, Desir GV: Expression of KCNA10, a voltage-gated K channel, in glomerular endothelium and at the apical membrane of the renal proximal tubule. J Am Soc Nephrol. 2002 Dec;13(12):2831-9. [PubMed:12444201 ]