Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08142
Secondary Accession Numbers
  • 13853
Name Potassium voltage-gated channel subfamily H member 1
Synonyms
  1. EAG channel 1
  2. Ether-a-go-go potassium channel 1
  3. Voltage-gated potassium channel subunit Kv10.1
  4. h-eag
  5. hEAG1
Gene Name KCNH1
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Pore-forming (alpha) subunit of voltage-gated non- inactivating delayed rectifier potassium channel. Channel properties may be modulated by cAMP and subunit assembly. Mediates IK(NI) current in myoblasts
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
protein histidine kinase activity
two-component sensor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
protein kinase activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
signaling process
signal transmission
two-component signal transduction system (phosphorelay)
establishment of localization
transport
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
regulation of cellular process
signal transduction
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32.2
SNPs KCNH1
Gene Sequence
>2970 bp
ATGACCATGGCTGGGGGCAGGAGGGGACTAGTGGCCCCTCAAAACACGTTTCTGGAGAAT
ATTGTTCGGCGGTCCAATGATACTAATTTTGTGTTGGGGAATGCTCAGATAGTGGACTGG
CCTATTGTGTACAGCAATGATGGATTTTGCAAGCTGTCTGGCTATCACAGGGCAGAAGTG
ATGCAAAAAAGCAGCACCTGCAGTTTTATGTATGGGGAGCTGACTGATAAAGACACGATT
GAAAAAGTGCGGCAAACATTTGAGAACTATGAGATGAATTCCTTTGAAATTCTGATGTAC
AAGAAGAACAGGACACCTGTGTGGTTCTTTGTGAAAATTGCTCCAATTCGAAACGAACAG
GATAAAGTGGTTTTATTTCTTTGCACTTTCAGTGACATAACAGCTTTCAAACAGCCAATT
GAGGATGATTCATGTAAAGGCTGGGGGAAGTTTGCTCGGCTGACAAGAGCACTGACAAGC
AGCAGGGGTGTCCTGCAGCAGCTGGCTCCAAGCGTGCAAAAAGGCGAGAATGTCCACAAG
CACTCCCGCCTGGCAGAGGTCCTACAGCTGGGCTCAGACATCCTTCCCCAGTACAAGCAA
GAGGCACCAAAGACTCCCCCTCACATCATCTTACATTATTGTGTTTTTAAGACCACGTGG
GATTGGATCATCTTGATCTTGACCTTCTATACAGCCATCTTGGTCCCTTATAATGTCTCC
TTCAAAACCAGGCAGAATAATGTGGCCTGGCTGGTTGTTGATAGCATCGTGGATGTTATC
TTTTTGGTGGACATTGTGCTCAATTTTCATACCACCTTTGTTGGACCAGCAGGGGAGGTG
ATTTCTGACCCCAAACTTATCCGCATGAACTACCTGAAGACGTGGTTTGTGATTGACCTT
CTGTCCTGTTTGCCATATGATGTCATCAACGCTTTTGAGAACGTGGATGAGGTTAGTGCC
TTTATGGGTGATCCAGGGAAGATTGGTTTTGCTGATCAGATTCCACCACCACTGGAGGGG
AGAGAGAGTCAGGGCATCAGCAGCCTGTTCAGCTCTCTAAAAGTTGTCCGGCTGCTCCGT
CTTGGGCGAGTGGCCCGTAAGCTGGACCACTACATTGAATATGGAGCTGCTGTGCTGGTC
CTGCTGGTGTGTGTGTTTGGGCTGGCTGCACACTGGATGGCCTGCATCTGGTACAGCATT
GGGGACTATGAGATCTTTGACGAGGACACCAAGACAATCCGCAACAACAGCTGGCTGTAC
CAACTAGCGATGGACATTGGCACCCCTTACCAGTTTAATGGGTCTGGCTCAGGGAAGTGG
GAAGGTGGTCCCAGCAAGAATTCTGTCTACATCTCCTCGTTGTATTTCACAATGACCAGC
CTCACCAGTGTGGGCTTTGGGAACATCGCCCCATCCACAGACATTGAGAAGATCTTTGCA
GTGGCCATCATGATGATTGGCTCACTTCTCTATGCCACCATCTTCGGGAATGTGACGACT
ATTTTCCAACAGATGTATGCCAACACCAACAGATACCATGAGATGCTCAACAGTGTTCGG
GACTTCCTGAAGCTCTACCAGGTGCCAAAAGGATTGAGTGAGCGAGTAATGGATTATATT
GTGTCCACTTGGTCCATGTCCAGAGGCATTGACACAGAGAAGGTCCTGCAGATCTGCCCC
AAGGACATGAGAGCCGACATCTGCGTGCACCTGAACCGCAAGGTGTTCAAGGAGCACCCG
GCCTTCCGGCTGGCCAGTGATGGCTGCCTCCGGGCACTGGCCATGGAGTTCCAGACGGTG
CACTGTGCCCCAGGGGACCTCATCTACCATGCAGGAGAGAGCGTTGACAGCCTCTGCTTT
GTGGTTTCTGGCTCCCTGGAGGTGATCCAAGATGATGAGGTGGTGGCCATTCTAGGAAAA
GGAGACGTGTTTGGAGATGTGTTCTGGAAGGAAGCCACCCTTGCCCAGTCCTGTGCCAAT
GTTAGGGCCTTGACCTACTGTGATCTGCATGTGATCAAGCGGGATGCCCTGCAGAAAGTG
CTGGAATTCTACACGGCCTTCTCCCATTCCTTCTCCCGGAACCTGATTCTGACGTACAAC
TTGAGGAAGAGGATTGTGTTCCGGAAGATCAGCGATGTGAAACGTGAAGAGGAAGAACGC
ATGAAACGAAAGAATGAGGCCCCCCTGATCTTGCCCCCGGACCACCCTGTCCGGCGCCTC
TTCCAGAGATTCCGACAGCAGAAAGAGGCCAGGCTGGCAGCTGAGAGAGGGGGCCGGGAC
CTGGATGACCTAGATGTGGAGAAGGGCAATGTCCTTACAGAGCATGCCTCCGCCAACCAC
AGCCTCGTGAAGGCCAGCGTGGTCACCGTGCGTGAGAGTCCTGCCACGCCCGTATCCTTC
CAGGCAGCCTCCACCTCCGGGGTGCCAGACCACGCAAAGCTACAGGCGCCAGGGTCCGAG
TGCCTGGGCCCCAAGGGGGGCGGGGGCGATTGTGCCAAGCGCAAAAGCTGGGCCCGCTTC
AAAGATGCTTGCGGGAAGAGTGAGGACTGGAACAAGGTGTCCAAGGCTGAGTCGATGGAG
ACACTTCCCGAGAGGACAAAAGCGTCAGGCGAGGCCACACTGAAGAAGACAGACTCGTGT
GACAGTGGCATCACCAAGAGCGACTTGCGCCTGGACAACGTGGGTGAGGCCAGGAGTCCC
CAGGATCGGAGTCCCATCCTGGCAGAGGTCAAGCATTCGTTCTACCCCATCCCTGAGCAG
ACGCTGCAGGCCACAGTCCTGGAGGTGAGGCACGAGCTGAAGGAGGACATCAAGGCCTTA
AACGCCAAAATGACCAATATTGAGAAACAGCTCTCTGAGATACTCAGGATATTAACTTCC
AGAAGATCCTCTCAGTCTCCTCAGGAGTTGTTTGAAATATCGAGGCCACAGTCCCCAGAA
TCAGAGAGAGACATTTTTGGAGCCAGCTGA
Protein Properties
Number of Residues 989
Molecular Weight 111421.8
Theoretical pI 7.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 221-241
  • 249-269
  • 295-315
  • 350-370
  • 377-397
  • 478-498
Protein Sequence
>Potassium voltage-gated channel subfamily H member 1
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLAMDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANH
SLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARF
KDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTDSCDSGITKSDLRLDNVGEARSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTS
RRSSQSPQELFEISRPQSPESERDIFGAS
GenBank ID Protein 27437001
UniProtKB/Swiss-Prot ID O95259
UniProtKB/Swiss-Prot Entry Name KCNH1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_172362.2
GeneCard ID KCNH1
GenAtlas ID KCNH1
HGNC ID HGNC:6250
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Occhiodoro T, Bernheim L, Liu JH, Bijlenga P, Sinnreich M, Bader CR, Fischer-Lougheed J: Cloning of a human ether-a-go-go potassium channel expressed in myoblasts at the onset of fusion. FEBS Lett. 1998 Aug 28;434(1-2):177-82. [PubMed:9738473 ]
  3. Pardo LA, del Camino D, Sanchez A, Alves F, Bruggemann A, Beckh S, Stuhmer W: Oncogenic potential of EAG K(+) channels. EMBO J. 1999 Oct 15;18(20):5540-7. [PubMed:10523298 ]
  4. Schonherr R, Lober K, Heinemann SH: Inhibition of human ether a go-go potassium channels by Ca(2+)/calmodulin. EMBO J. 2000 Jul 3;19(13):3263-71. [PubMed:10880439 ]
  5. Schonherr R, Gessner G, Lober K, Heinemann SH: Functional distinction of human EAG1 and EAG2 potassium channels. FEBS Lett. 2002 Mar 13;514(2-3):204-8. [PubMed:11943152 ]