Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08144
Secondary Accession Numbers
  • 13855
Name Potassium voltage-gated channel subfamily H member 4
Synonyms
  1. BEC2
  2. Brain-specific eag-like channel 2
  3. ELK channel 1
  4. ELK1
  5. Ether-a-go-go-like potassium channel 1
  6. Voltage-gated potassium channel subunit Kv12.3
Gene Name KCNH4
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits an outward current, but shows no inactivation. Channel properties may be modulated by cAMP and subunit assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
protein histidine kinase activity
two-component sensor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
protein kinase activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
signaling process
signal transmission
two-component signal transduction system (phosphorelay)
establishment of localization
transport
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
regulation of cellular process
signal transduction
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q21.2
SNPs KCNH4
Gene Sequence
>3054 bp
ATGCCGGTCATGAAGGGGTTGCTGGCCCCGCAAAACACCTTCCTGGACACCATCGCCACC
CGTTTTGACGGAACGCACAGCAACTTCCTGCTGGCCAACGCACAGGGCACACGGGGCTTT
CCCATCGTCTACTGCTCCGACGGCTTCTGCGAGCTCACAGGCTACGGTCGCACCGAGGTC
ATGCAGAAGACCTGCAGCTGCCGTTTCCTCTACGGCCCAGAGACCAGTGAGCCAGCCCTG
CAGCGTCTGCACAAAGCCCTGGAGGGCCACCAGGAGCACCGGGCTGAAATCTGCTTCTAC
CGCAAGGATGGCTCAGCCTTTTGGTGCCTCCTGGACATGATGCCCATCAAGAATGAGATG
GGGGAGGTCGTGCTGTTCCTCTTTTCCTTCAAGGATATCACTCAGAGTGGAAGCCCAGGA
CTTGGCCCCCAAGGAGGCCGCGGGGACAGTAATCACGAAAACTCCCTTGGTAGAAGGGGA
GCCACCTGGAAATTTCGGTCTGCCAGAAGACGGAGCCGTACTGTCCTACACCGACTGACC
GGCCACTTTGGCCGCCGGGGCCAGGGAGGCATGAAGGCCAATAATAACGTGTTTGAGCCA
AAGCCATCAGTGCCCGAGTACAAGGTGGCCTCCGTGGGGGGGTCTCGCTGCCTCCTCCTC
CACTACAGCGTCTCCAAGGCCATCTGGGACGGCCTTATCCTCCTTGCCACCTTCTACGTT
GCGGTCACCGTCCCCTACAATGTCTGTTTCTCGGGTGACGATGACACCCCCATCACTTCG
CGACACACCCTTGTCAGCGACATCGCCGTGGAAATGCTCTTCATCCTAGATATCATCCTG
AACTTCCGCACCACCTATGTGTCCCAGTCCGGCCAGGTAATCTCTGCTCCTCGTTCCATT
GGCCTCCACTACCTGGCCACCTGGTTCTTCATCGACCTTATTGCTGCTCTGCCCTTTGAC
CTGCTTTACATCTTCAACATCACCGTGACCTCGCTGGTGCACCTACTGAAGACAGTGCGG
CTGTTGCGGCTGCTGCGGCTGCTGCAGAAGCTGGAGCGGTACTCTCAGTGCAGTGCTGTG
GTGCTCACGCTGCTCATGTCGGTCTTTGCGCTCCTTGCCCACTGGATGGCCTGCATCTGG
TATGTCATCGGGCGCCGGGAGATGGAGGCCAATGACCCGCTGCTCTGGGACATTGGCTGG
TTGCATGAGTTGGGCAAGCGTCTGGAGGTGCCCTATGTCAATGGCTCGGTGGGCGGCCCA
TCACGGCGCAGCGCCTACATCGCGGCACTGTACTTCACTCTAAGCAGCCTCACCAGTGTG
GGCTTTGGCAACGTGTGTGCCAACACCGACGCGGAGAAGATCTTCTCCATCTGCACGATG
CTCATAGGCGCCCTGATGCACGCTGTGGTGTTCGGGAACGTGACAGCCATCATCCAGCGC
ATGTACTCGCGCCGCTCGCTCTACCACAGCCGCATGAAGGACCTCAAGGACTTCATCCGT
GTGCACCGCCTGCCGCGGCCGCTCAAGCAGCGCATGCTCGAATACTTCCAGACCACGTGG
GCCGTCAACAGCGGCATCGACGCCAACGAGTTACTGCGTGACTTCCCAGACGAGCTGAGA
GCTGACATTGCTATGCACCTGAATCGGGAGATCCTGCAGCTGCCGTTGTTCGGGGCAGCG
AGCAGGGGCTGCCTGCGGGCCCTATCGCTGCACATCAAGACCTCGTTCTGCGCTCCGGGC
GAGTACCTGTTGCGCCGTGGGGATGCCCTGCAGGCACATTACTATGTCTGCTCCGGCTCG
CTTGAGGTGCTCCGAGACAACATGGTGCTGGCCATCCTGGGGAAGGGGGACCTGATTGGA
GCAGATATCCCTGAGCCGGGGCAGGAGCCTGGGTTGGGAGCAGACCCAAACTTCGTGCTA
AAGACCAGTGCTGATGTGAAAGCTCTGACCTACTGTGGCCTGCAGCAGCTGAGCAGCCGA
GGGCTGGCTGAGGTCCTGAGGCTCTATCCTGAGTATGGGGCTGCCTTCCGGGCTGGCCTG
CCCCGGGACCTCACCTTCAACCTGCGCCAGGGCTCTGACACCAGTGGCCTCAGCCGCTTT
TCCCGATCCCCTCGCCTCTCCCAGCCCCGCTCAGAAAGCCTCGGCTCCTCCTCAGACAAG
ACGCTGCCATCCATCACAGAGGCCGAGAGTGGCGCGGAGCCTGGGGGTGGTCCCAGGCCC
CGACGGCCCCTCCTGCTGCCCAACCTCAGCCCAGCACGGCCTCGGGGCTCCCTGGTCAGC
CTTTTGGGCGAGGAGCTGCCCCCATTCTCAGCCCTTGTCTCCTCTCCTTCCTTATCCCCA
TCCCTGTCCCCTGCCCTGGCTGGCCAGGGCCACAGTGCCTCCCCTCACGGCCCCCCCAGG
TGCTCTGCTGCCTGGAAGCCCCCTCAGCTTCTCATTCCCCCACTGGGAACCTTTGGACCT
CCGGACCTCAGTCCCCGGATAGTGGATGGCATTGAGGACTCTGGCAGCACAGCTGAGGCC
CCTTCATTCCGATTCAGCAGGAGGCCTGAACTGCCAAGGCCCCGCTCCCAGGCGCCCCCT
ACAGGGACCAGGCCCAGCCCAGAATTGGCCAGTGAGGCTGAGGAGGTGAAGGAAAAGGTT
TGCCGGCTGAACCAGGAGATCTCTCGTCTCAATCAGGAGGTGTCTCAGCTTAGCCGGGAG
CTGCGGCACATCATGGGCCTGCTGCAGGCCAGGCTGGGTCCCCCAGGCCACCCAGCAGGC
TCCGCTTGGACCCCAGACCCTCCTTGTCCACAGCTGAGGCCACCATGCCTCTCTCCTTGT
GCGTCCAGACCACCACCCAGCCTCCAGGATACTACGCTTGCTGAAGTTCACTGCCCAGCC
AGTGTGGGGACCATGGAGACAGGGACTGCGCTCCTGGACTTGAGACCTTCCATATTGCCC
CCCTACCCCTCAGAGCCTGACCCTCTGGGACCCTCTCCAGTGCCAGAGGCCTCACCCCCA
ACCCCAAGCCTCTTGAGGCACAGTTTCCAGTCCAGGTCAGACACGTTCCACTGA
Protein Properties
Number of Residues 1017
Molecular Weight 111692.1
Theoretical pI 8.63
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 229-249
  • 260-280
  • 303-323
  • 333-353
  • 362-382
  • 483-503
Protein Sequence
>Potassium voltage-gated channel subfamily H member 4
MPVMKGLLAPQNTFLDTIATRFDGTHSNFLLANAQGTRGFPIVYCSDGFCELTGYGRTEV
MQKTCSCRFLYGPETSEPALQRLHKALEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEM
GEVVLFLFSFKDITQSGSPGLGPQGGRGDSNHENSLGRRGATWKFRSARRRSRTVLHRLT
GHFGRRGQGGMKANNNVFEPKPSVPEYKVASVGGSRCLLLHYSVSKAIWDGLILLATFYV
AVTVPYNVCFSGDDDTPITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSI
GLHYLATWFFIDLIAALPFDLLYIFNITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAV
VLTLLMSVFALLAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGP
SRRSAYIAALYFTLSSLTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQR
MYSRRSLYHSRMKDLKDFIRVHRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELR
ADIAMHLNREILQLPLFGAASRGCLRALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGS
LEVLRDNMVLAILGKGDLIGADIPEPGQEPGLGADPNFVLKTSADVKALTYCGLQQLSSR
GLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTSGLSRFSRSPRLSQPRSESLGSSSDK
TLPSITEAESGAEPGGGPRPRRPLLLPNLSPARPRGSLVSLLGEELPPFSALVSSPSLSP
SLSPALAGQGHSASPHGPPRCSAAWKPPQLLIPPLGTFGPPDLSPRIVDGIEDSGSTAEA
PSFRFSRRPELPRPRSQAPPTGTRPSPELASEAEEVKEKVCRLNQEISRLNQEVSQLSRE
LRHIMGLLQARLGPPGHPAGSAWTPDPPCPQLRPPCLSPCASRPPPSLQDTTLAEVHCPA
SVGTMETGTALLDLRPSILPPYPSEPDPLGPSPVPEASPPTPSLLRHSFQSRSDTFH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UQ05
UniProtKB/Swiss-Prot Entry Name KCNH4_HUMAN
PDB IDs Not Available
GenBank Gene ID AB022698
GeneCard ID KCNH4
GenAtlas ID KCNH4
HGNC ID HGNC:6253
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Miyake A, Mochizuki S, Yokoi H, Kohda M, Furuichi K: New ether-a-go-go K(+) channel family members localized in human telencephalon. J Biol Chem. 1999 Aug 27;274(35):25018-25. [PubMed:10455180 ]