You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08146
Secondary Accession Numbers
  • 13857
Name Potassium voltage-gated channel subfamily H member 7
Synonyms
  1. ERG-3
  2. Eag-related protein 3
  3. Ether-a-go-go-related gene potassium channel 3
  4. Ether-a-go-go-related protein 3
  5. Voltage-gated potassium channel subunit Kv11.3
  6. hERG-3
Gene Name KCNH7
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Pore-forming (alpha) subunit of voltage-gated potassium channel. Channel properties may be modulated by cAMP and subunit assembly
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
regulation of cellular process
signal transduction
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q24.2
SNPs KCNH7
Gene Sequence
>3591 bp
ATGCCTGTGCGCAGGGGGCATGTGGCACCACAAAATACATTTCTGGGGACCATCATTCGG
AAATTTGAAGGGCAAAATAAAAAATTTATCATTGCAAATGCCAGAGTGCAGAACTGTGCC
ATCATTTATTGCAACGATGGGTTCTGTGAGATGACTGGTTTCTCCAGGCCAGATGTCATG
CAAAAGCCATGCACCTGCGACTTTCTCCATGGACCCGAGACCAAGAGGCATGATATTGCC
CAAATTGCCCAGGCATTGCTGGGGTCAGAAGAGAGGAAAGTGGAGGTCACCTACTATCAC
AAAAATGGGTCCACTTTTATTTGTAACACTCACATAATTCCAGTGAAAAACCAAGAGGGC
GTGGCTATGATGTTCATCATTAATTTTGAATATGTGACGGATAATGAAAACGCTGCCACC
CCAGAGAGGGTAAACCCAATATTACCAATCAAAACTGTAAACCGGAAATTTTTTGGGTTC
AAATTCCCTGGTCTGAGAGTTCTCACTTACAGAAAGCAGTCCTTACCACAAGAAGACCCC
GATGTGGTGGTCATCGATTCATCTAAACACAGTGATGATTCAGTAGCCATGAAGCATTTT
AAGTCTCCTACAAAAGAAAGCTGCAGCCCCTCTGAAGCAGATGACACAAAAGCTTTGATA
CAGCCCAGCAAATGTTCTCCCTTGGTGAATATATCCGGACCTCTTGACCATTCCTCTCCC
AAAAGGCAATGGGACCGACTCTACCCTGACATGCTGCAGTCAAGTTCCCAGCTGTCCCAT
TCCAGATCAAGGGAAAGCTTATGTAGTATACGGAGAGCATCTTCGGTCCATGATATAGAA
GGATTCGGCGTCCACCCCAAGAACATATTTAGAGACCGACATGCCAGCGAAGACAATGGT
CGCAATGTCAAAGGGCCTTTTAATCATATCAAGTCAAGCCTCCTGGGATCCACATCAGAT
TCAAACCTCAACAAATACAGCACCATTAACAAGATTCCACAGCTCACTCTGAATTTTTCA
GAGGTCAAAACTGAGAAAAAGAATTCATCACCTCCTTCTTCAGATAAAACCATTATTGCA
CCCAAGGTTAAAGATCGAACACACAATGTGACTGAGAAAGTGACCCAGGTTCTCTCTTTA
GGAGCAGATGTCCTACCTGAATACAAACTGCAGACACCACGCATCAACAAGTTTACGATA
TTGCACTACAGCCCTTTCAAGGCAGTCTGGGACTGGCTTATCCTGCTGTTGGTCATATAC
ACTGCTATATTTACTCCCTACTCTGCAGCCTTCCTCCTCAATGACAGAGAAGAACAGAAA
AGACGAGAATGTGGCTATTCTTGTAGCCCTTTGAATGTGGTAGACTTGATTGTGGATATT
ATGTTTATCATAGATATTTTAATAAACTTCAGAACAACATATGTAAATCAGAATGAAGAA
GTGGTAAGTGATCCCGCCAAAATAGCAATACACTACTTCAAAGGCTGGTTCCTGATTGAC
ATGGTTGCAGCAATTCCTTTTGACTTGCTGATTTTTGGATCAGGTTCTGATGAGACAACA
ACATTAATTGGTCTTTTGAAGACTGCCCGACTCCTCCGTCTTGTGCGCGTGGCCAGGAAA
CTGGATCGATATTCAGAATATGGCGCTGCTGTTCTAATGCTCTTAATGTGCATCTTTGCC
CTGATTGCTCACTGGCTGGCTTGCATTTGGTATGCGATTGGGAATGTAGAAAGGCCTTAC
CTGACTGACAAAATCGGATGGTTGGATTCCTTAGGACAGCAAATTGGGAAACGTTACAAT
GACAGTGACTCAAGTTCTGGACCATCCATTAAAGACAAATACGTCACAGCACTTTATTTT
ACCTTCAGCAGTTTAACCAGTGTAGGATTCGGGAATGTGTCTCCTAACACGAATTCGGAG
AAAATCTTTTCAATTTGTGTCATGTTGATTGGCTCACTAATGTATGCAAGCATTTTTGGG
AATGTATCTGCAATTATCCAAAGACTATACTCGGGAACTGCCAGGTACCACATGCAGATG
CTGCGAGTAAAAGAGTTCATTCGCTTTCACCAAATCCCCAACCCTCTGAGGCAACGTCTT
GAAGAATATTTCCAGCACGCATGGACTTACACCAATGGCATTGACATGAACATGGTCCTA
AAGGGTTTCCCAGAATGCTTACAAGCAGACATTTGTCTACATCTCAACCAGACATTGCTG
CAAAACTGCAAAGCCTTTCGGGGGGCAAGTAAAGGTTGCCTTAGAGCTTTGGCAATGAAG
TTCAAAACCACCCATGCACCTCCAGGAGACACCCTCGTTCACTGTGGGGATGTCCTCACT
GCACTTTATTTCTTATCCAGAGGCTCCATTGAAATTCTCAAAGATGACATTGTGGTGGCT
ATTCTGGGAAAAAATGATATATTTGGAGAAATGGTTCATCTTTATGCCAAACCTGGAAAG
TCTAATGCAGATGTAAGAGCCCTCACATACTGTGACTTGCATAAGATTCAGCGAGAAGAC
TTGTTAGAGGTTTTGGATATGTATCCTGAGTTTTCTGATCACTTTCTAACAAACCTAGAG
TTGACTTTCAACCTAAGGCATGAGAGCGCAAAGGCTGATCTCCTACGATCACAATCCATG
AATGATTCAGAAGGAGACAACTGTAAACTAAGAAGAAGGAAATTGTCATTTGAAAGTGAA
GGAGAGAAAGAAAACAGTACAAATGATCCTGAAGACTCTGCAGATACCATAAGACATTAT
CAGAGTTCCAAGAGACACTTTGAAGAGAAAAAAAGCAGATCCTCATCTTTCATCTCCTCC
ATTGATGATGAACAAAAGCCGCTCTTCTCAGGAATAGTAGACTCTTCTCCAGGAATAGGG
AAAGCATCTGGGCTCGATTTTGAAGAAACAGTGCCCACCTCAGGAAGAATGCACATAGAT
AAAAGAAGTCACTCTTGCAAAGATATCACTGACATGCGAAGCTGGGAACGAGAAAATGCA
CATCCCCAGCCTGAAGACTCCAGTCCATCTGCACTTCAGCGAGCTGCCTGGGGTATCTCT
GAAACCGAAAGCGACCTCACCTACGGGGAAGTGGAACAAAGATTAGATCTGCTCCAGGAG
CAACTTAACAGGCTTGAATCCCAAATGACCACTGACATCCAGACCATCTTACAGTTGCTG
CAGAAACAAACCACTGTGGTCCCCCCAGCCTACAGTATGGTAACAGCAGGATCAGAATAT
CAGAGACCCATCATCCAGCTGATGAGAACCAGTCAACCGGAAGCATCCATCAAAACTGAC
CGAAGTTTCAGCCCTTCCTCACAATGTCCTGAATTTCTAGACCTTGAAAAATCTAAACTT
AAATCCAAAGAATCCCTTTCAAGTGGGGTGCATCTGAACACAGCTTCAGAAGACAACTTG
ACTTCACTTTTAAAACAAGACAGTGATCTCTCTTTAGAGCTTCACCTGCGGCAAAGAAAA
ACTTACGTTCATCCAATTAGGCATCCTTCTTTGCCAGATTCATCCCTAAGCACTGTAGGA
ATCGTGGGTCTTCATAGGCATGTTTCTGATCCTGGTCTTCCAGGGAAATAA
Protein Properties
Number of Residues 1196
Molecular Weight 134998.5
Theoretical pI 7.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 413-433
  • 450-470
  • 495-515
  • 522-542
  • 550-570
  • 642-662
Protein Sequence
>Potassium voltage-gated channel subfamily H member 7
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK
GenBank ID Protein 27886653
UniProtKB/Swiss-Prot ID Q9NS40
UniProtKB/Swiss-Prot Entry Name KCNH7_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_033272.2
GeneCard ID KCNH7
GenAtlas ID KCNH7
HGNC ID HGNC:18863
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  4. Bauer CK, Wulfsen I, Schafer R, Glassmeier G, Wimmers S, Flitsch J, Ludecke DK, Schwarz JR: HERG K(+) currents in human prolactin-secreting adenoma cells. Pflugers Arch. 2003 Feb;445(5):589-600. Epub 2002 Dec 6. [PubMed:12634931 ]