You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08168
Secondary Accession Numbers
  • 13879
Name Relaxin-3 receptor 2
Synonyms
  1. G-protein coupled receptor 100
  2. G-protein coupled receptor GPCR142
  3. Insulin-like peptide INSL5 receptor
  4. RLN3 receptor 2
  5. Relaxin family peptide receptor 4
Gene Name RXFP4
Protein Type Unknown
Biological Properties
General Function Involved in G-protein coupled receptor protein signaling pathway
Specific Function High affinity receptor for INSL5. Also acts as receptor for RLN3/relaxin-3, as well as bradykinin and kallidin. Binding of the ligand inhibit cAMP accumulation
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
receptor activity
angiotensin receptor activity
angiotensin type ii receptor activity
molecular transducer activity
signal transducer activity
peptide receptor activity
peptide receptor activity, g-protein coupled
Process
signaling
signaling pathway
cell surface receptor linked signaling pathway
g-protein coupled receptor protein signaling pathway
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q22
SNPs RXFP4
Gene Sequence
>1125 bp
ATGCCCACACTCAATACTTCTGCCTCTCCACCCACATTCTTCTGGGCCAATGCCTCCGGA
GGCAGTGTGCTGAGTGCTGATGATGCTCCGATGCCTGTCAAATTCCTAGCCCTGAGGCTC
ATGGTTGCCCTGGCCTATGGGCTTGTGGGGGCCATTGGCTTGCTGGGAAATTTGGCGGTG
CTGTGGGTACTGAGTAACTGTGCCCGGAGAGCCCCTGGCCCACCTTCAGACACCTTCGTC
TTCAACCTGGCTCTGGCGGACCTGGGACTGGCACTCACTCTCCCCTTTTGGGCAGCCGAG
TCGGCACTGGACTTTCACTGGCCCTTCGGAGGTGCCCTCTGCAAGATGGTTCTGACGGCC
ACTGTCCTCAACGTCTATGCCAGCATCTTCCTCATCACAGCGCTGAGCGTTGCTCGCTAC
TGGGTGGTGGCCATGGCTGCGGGGCCAGGCACCCACCTCTCACTCTTCTGGGCCCGAATA
GCCACCCTGGCAGTGTGGGCGGCGGCTGCCCTGGTGACGGTGCCCACAGCTGTCTTCGGG
GTGGAGGGTGAGGTGTGTGGTGTGCGCCTTTGCCTGCTGCGTTTCCCCAGCAGGTACTGG
CTGGGGGCCTACCAGCTGCAGAGGGTGGTGCTGGCTTTCATGGTGCCCTTGGGCGTCATC
ACCACCAGCTACCTGCTGCTGCTGGCCTTCCTGCAGCGGCGGCAACGGCGGCGGCAGGAC
AGCAGGGTCGTGGCCCGCTCTGTCCGCATCCTGGTGGCTTCCTTCTTCCTCTGCTGGTTT
CCCAACCATGTGGTCACTCTCTGGGGTGTCCTGGTGAAGTTTGACCTGGTGCCCTGGAAC
AGTACTTTCTATACTATCCAGACGTATGTCTTCCCTGTCACTACTTGCTTGGCACACAGC
AATAGCTGCCTCAACCCTGTGCTGTACTGTCTCCTGAGGCGGGAGCCCCGGCAGGCTCTG
GCAGGCACCTTCAGGGATCTGCGGTTGAGGCTGTGGCCCCAGGGCGGAGGCTGGGTGCAA
CAGGTGGCCCTAAAGCAGGTAGGCAGGCGGTGGGTCGCAAGCAACCCCCGGGAGAGCCGC
CCTTCTACCCTGCTCACCAACCTGGACAGAGGGACACCCGGGTGA
Protein Properties
Number of Residues 374
Molecular Weight 41141.0
Theoretical pI 10.65
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 44-64
  • 79-99
  • 117-137
  • 155-175
  • 210-230
  • 250-270
  • 282-302
Protein Sequence
>Relaxin-3 receptor 2
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAV
LWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTA
TVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFG
VEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQD
SRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHS
NSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESR
PSTLLTNLDRGTPG
GenBank ID Protein 20152250
UniProtKB/Swiss-Prot ID Q8TDU9
UniProtKB/Swiss-Prot Entry Name RL3R2_HUMAN
PDB IDs Not Available
GenBank Gene ID AB083593
GeneCard ID RXFP4
GenAtlas ID RXFP4
HGNC ID HGNC:14666
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Takeda S, Kadowaki S, Haga T, Takaesu H, Mitaku S: Identification of G protein-coupled receptor genes from the human genome sequence. FEBS Lett. 2002 Jun 5;520(1-3):97-101. [PubMed:12044878 ]
  4. Liu C, Chen J, Sutton S, Roland B, Kuei C, Farmer N, Sillard R, Lovenberg TW: Identification of relaxin-3/INSL7 as a ligand for GPCR142. J Biol Chem. 2003 Dec 12;278(50):50765-70. Epub 2003 Sep 30. [PubMed:14522967 ]
  5. Fredriksson R, Hoglund PJ, Gloriam DE, Lagerstrom MC, Schioth HB: Seven evolutionarily conserved human rhodopsin G protein-coupled receptors lacking close relatives. FEBS Lett. 2003 Nov 20;554(3):381-8. [PubMed:14623098 ]
  6. Boels K, Schaller HC: Identification and characterisation of GPR100 as a novel human G-protein-coupled bradykinin receptor. Br J Pharmacol. 2003 Nov;140(5):932-8. Epub 2003 Oct 6. [PubMed:14530218 ]
  7. Liu C, Kuei C, Sutton S, Chen J, Bonaventure P, Wu J, Nepomuceno D, Kamme F, Tran DT, Zhu J, Wilkinson T, Bathgate R, Eriste E, Sillard R, Lovenberg TW: INSL5 is a high affinity specific agonist for GPCR142 (GPR100). J Biol Chem. 2005 Jan 7;280(1):292-300. Epub 2004 Nov 2. [PubMed:15525639 ]