Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08176
Secondary Accession Numbers
  • 13887
Name Transmembrane protein 132A
Synonyms
  1. HSPA5-binding protein 1
Gene Name TMEM132A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Golgi apparatus membrane
  2. Endoplasmic reticulum membrane
  3. Single-pass type I membrane protein
  4. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 11q12.2
SNPs TMEM132A
Gene Sequence
>3072 bp
ATGTGCGCGCGGATGGCCGGTCGCACAACAGCGGCCCCTCGGGGGCCCTACGGCCCCTGG
CTCTGCCTCCTGGTGGCCCTCGCCCTGGACGTCGTGAGAGTGGACTGTGGCCAGGCTCCC
CTGGACCCTGTCTACCTGCCGGCAGCCCTGGAGCTCCTAGACGCCCCTGAACACTTCCGT
GTGCAGCAGGTGGGCCACTACCCACCTGCCAACTCCTCTCTGAGCTCCCGATCTGAGACC
TTTCTGCTCCTACAGCCCTGGCCCAGGGCCCAGCCACTTCTCCGGGCCTCCTACCCACCT
TTTGCCACTCAGCAGGTGGTCCCCCCTCGAGTCACTGAGCCCCACCAACGGCCAGTCCCA
TGGGACGTGCGGGCCGTTTCAGTGGAAGCGGCTGTGACTCCAGCAGAGCCCTACGCCCGG
GTTCTCTTCCACCTCAAAGGGCAGGATTGGCCACCAGGGTCTGGCAGCCTGCCCTGTGCC
CGGCTCCATGCCACACACCCTGCCGGCACTGCTCACCAAGCCTGCCGCTTCCAGCCATCC
CTGGGCGCCTGCGTGGTGGAGCTGGAGCTTCCCTCGCACTGGTTCTCACAGGCCTCCACC
ACACGGGCCGAGCTGGCCTACACGCTTGAGCCTGCAGCTGAGGGCCCTGGGGGCTGTGGC
TCCGGCGAGGAGAACGACCCTGGGGAGCAGGCCCTCCCAGTGGGGGGTGTGGAGCTGCGC
CCAGCAGACCCCCCGCAGTACCAGGAGGTACCTCTGGACGAGGCTGTGACTCTGCGGGTG
CCTGACATGCCAGTGCGGCCCGGCCAGCTCTTTAGTGCTACCCTCCTGCTTCGGCACAAC
TTCACAGCCAGCCTCCTGACCCTGCGGATCAAGGTGAAGAAGGGGCTGCATGTGACAGCC
GCCCGCCCAGCCCAGCCCACACTCTGGACTGCCAAGCTGGACCGCTTCAAGGGCTCCAGG
CACCACACCACCCTCATCACCTGCCACCGTGCTGGGCTCACAGAGCCAGATTCCAGTCCC
CTTGAACTGTCTGAGTTCCTATGGGTGGACTTTGTGGTGGAGAATAGCACTGGTGGGGGC
GTAGCGGTCACTCGCCCCGTCACGTGGCAGCTGGAGTACCCAGGCCAGGCCCCTGAAGCA
GAGAAGGACAAAATGGTGTGGGAAATCCTGGTGTCTGAGCGGGACATCAGAGCCCTTATC
CCACTGGCCAAGGCTGAGGAGCTGGTGAATACAGCACCACTGACTGGAGTGCCCCAGCAT
GTCCCCGTGCGCCTTGTCACTGTGGACGGCGGGGGGGCCTTGGTGGAGGTGACAGAGCAT
GTCGGCTGCGAGTCTGCCAACACACAGGTCCTGCAGGTGTCTGAGGCCTGTGATGCCGTG
TTCGTGGCTGGCAAGGAGAGCCGGGGCGCCCGGGGGGTGCGAGTGGACTTCTGGTGGCGC
CGGCTCCGCGCCTCGCTGCGGCTGACCGTGTGGGCCCCCCTGCTACCGCTGCGTATCGAG
CTCACCGACACCACCCTCGAGCAGGTCCGCGGCTGGAGGGTACCTGGCCCTGCTGAAGGG
CCTGCGGAACCCGCTGCAGAGGCGTCGGATGAGGCCGAGCGGCGCGCCCGTGGCTGCCAC
CTGCAGTACCAGCGGGCCGGTGTGCGCTTCCTCGCCCCCTTCGCGGCCCACCCGCTGGAC
GGCGGCCGCCGCCTCACGCACCTGCTTGGCCCCGACTGGCTGCTAGACGTGTCCCACCTC
GTGGCGCCACACGCCCGCGTGCTGGACTCGCGTGTAGCCTCTCTGGAGGGTGGCCGTGTC
GTGGTGGGCCGGGAGCCCGGTGTCACCTCCATTGAGGTGCGTTCCCCACTGTCTGACTCC
ATCCTGGGGGAGCAGGCGCTGGCTGTGACGGACGACAAGGTCTCAGTGCTGGAGCTGAGG
GTGCAGCCAGTGATGGGCATCTCGCTGACCTTGAGCCGGGGCACTGCCCACCCCGGGGAG
GTCACAGCTACGTGCTGGGCACAGTCAGCCCTTCCCGCCCCAAAGCAGGAGGTGGCCCTC
TCCCTATGGCTGTCCTTCTCTGATCACACTGTGGCCCCAGCTGAGCTCTACGACCGCCGT
GACCTGGGACTGTCCGTCTCAGCCGAGGAGCCTGGTGCCATCCTGCCAGCTGAGGAGCAG
GGTGCCCAGCTCGGGGTGGTGGTGAGTGGGGCAGGCGCCGAGGGGCTGCCGCTGCATGTG
GCTCTGCACCCGCCCGAGCCCTGCCGCCGGGGCCGCCACCGTGTGCCTCTGGCCTCTGGC
ACCGCCTGGCTGGGGCTGCCCCCTGCCTCCACTCCAGCCCCTGCTCTCCCATCCAGCCCT
GCTTGGAGCCCACCAGCCACAGAAGCCACCATGGGTGGTAAACGGCAGGTGGCAGGCAGT
GTCGGGGGCAACACAGGTGTGAGGGGCAAGTTTGAGCGGGCAGAGGAGGAGGCCAGGAAG
GAGGAGACCGAAGCCAGGGAGGAGGAGGAGGAAGAGGAGGAGGAGATGGTCCCTGCCCCT
CAGCATGTCACTGAGCTAGAGCTGGGCATGTACGCCCTGCTGGGAGTCTTCTGCGTGGCC
ATCTTCATCTTCTTGGTCAATGGTGTGGTCTTCGTCCTGCGCTATCAGCGCAAAGAACCT
CCCGACAGTGCCACTGACCCCACCTCCCCCCAGCCCCACAACTGGGTCTGGCTGGGCACT
GACCAGGAGGAACTGAGCCGCCAGCTGGACCGGCAGTCCCCTGGCCCGCCCAAGGGGGAG
GGGAGCTGCCCCTGTGAGAGTGGGGGAGGAGGGGAGGCCCCTACCCTGGCCCCTGGCCCT
CCTGGGGGCACCACCAGCTCCTCAAGCACCCTGGCCCGAAAGGAGGCTGGGGGGCGGCGG
AAGCGAGTAGAGTTTGTGACATTTGCGCCAGCCCCTCCAGCCCAGTCACCTGAGGAGCCT
GTAGGGGCCCCTGCTGTGCAGTCCATCCTTGTGGCAGGCGAGGAGGACATCCGCTGGGTG
TGTGAGGACATGGGGCTGAAGGACCCTGAGGAGCTTCGCAACTACATGGAGAGGATCCGG
GGCAGCTCCTGA
Protein Properties
Number of Residues 1023
Molecular Weight 110108.9
Theoretical pI 5.36
Pfam Domain Function Not Available
Signals
  • 1-35
Transmembrane Regions
  • 853-873
Protein Sequence
>Transmembrane protein 132A
MCARMAGRTTAAPRGPYGPWLCLLVALALDVVRVDCGQAPLDPVYLPAALELLDAPEHFR
VQQVGHYPPANSSLSSRSETFLLLQPWPRAQPLLRASYPPFATQQVVPPRVTEPHQRPVP
WDVRAVSVEAAVTPAEPYARVLFHLKGQDWPPGSGSLPCARLHATHPAGTAHQACRFQPS
LGACVVELELPSHWFSQASTTRAELAYTLEPAAEGPGGCGSGEENDPGEQALPVGGVELR
PADPPQYQEVPLDEAVTLRVPDMPVRPGQLFSATLLLRHNFTASLLTLRIKVKKGLHVTA
ARPAQPTLWTAKLDRFKGSRHHTTLITCHRAGLTEPDSSPLELSEFLWVDFVVENSTGGG
VAVTRPVTWQLEYPGQAPEAEKDKMVWEILVSERDIRALIPLAKAEELVNTAPLTGVPQH
VPVRLVTVDGGGALVEVTEHVGCESANTQVLQVSEACDAVFVAGKESRGARGVRVDFWWR
RLRASLRLTVWAPLLPLRIELTDTTLEQVRGWRVPGPAEGPAEPAAEASDEAERRARGCH
LQYQRAGVRFLAPFAAHPLDGGRRLTHLLGPDWLLDVSHLVAPHARVLDSRVASLEGGRV
VVGREPGVTSIEVRSPLSDSILGEQALAVTDDKVSVLELRVQPVMGISLTLSRGTAHPGE
VTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQ
GAQLGVVVSGAGAEGLPLHVALHPPEPCRRGRHRVPLASGTAWLGLPPASTPAPALPSSP
AWSPPATEATMGGKRQVAGSVGGNTGVRGKFERAEEEARKEETEAREEEEEEEEEMVPAP
QHVTELELGMYALLGVFCVAIFIFLVNGVVFVLRYQRKEPPDSATDPTSPQPHNWVWLGT
DQEELSRQLDRQSPGPPKGEGSCPCESGGGGEAPTLAPGPPGGTTSSSSTLARKEAGGRR
KRVEFVTFAPAPPAQSPEEPVGAPAVQSILVAGEEDIRWVCEDMGLKDPEELRNYMERIR
GSS
GenBank ID Protein 30089937
UniProtKB/Swiss-Prot ID Q24JP5
UniProtKB/Swiss-Prot Entry Name T132A_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_178031.2
GeneCard ID TMEM132A
GenAtlas ID TMEM132A
HGNC ID HGNC:31092
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Nagase T, Kikuno R, Nakayama M, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Aug 31;7(4):273-81. [PubMed:10997877 ]