You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08186
Secondary Accession Numbers
  • 13897
Name H(+)/Cl(-) exchange transporter 4
Synonyms
  1. Chloride channel protein 4
  2. Chloride transporter ClC-4
  3. ClC-4
Gene Name CLCN4
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
early endosome membrane
late endosome membrane
integral to membrane
Component
membrane
cell part
Function
voltage-gated chloride channel activity
anion channel activity
chloride channel activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
Molecular Function
ATP binding
antiporter activity
voltage-gated chloride channel activity
Process
establishment of localization
transport
chloride transport
transmembrane transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Late endosome membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Early endosome membrane
Gene Properties
Chromosome Location X
Locus Xp22.3
SNPs CLCN4
Gene Sequence
>2283 bp
ATGGTCAATGCGGGAGCGATGAGTGGCTCTGGAAACCTGATGGATTTCCTCGATGAGCCG
TTCCCTGATGTGGGGACGTATGAGGACTTCCACACCATCGACTGGCTAAGGGAAAAGTCA
CGGGACACCGACAGACACAGGAAGATCACCAGCAAGAGCAAGGAGTCCATATGGGAGTTC
ATCAAGAGCCTGCTGGATGCCTGGTCGGGATGGGTGGTGATGCTGCTCATCGGCCTGCTG
GCGGGCACCTTGGCTGGGGTCATCGATCTCGCCGTGGACTGGATGACGGACCTGAAGGAG
GGGGTCTGCCTGTCTGCCTTCTGGTATAGCCATGAGCAGTGTTGCTGGACTTCTAACGAG
ACCACTTTTGAGGACAGAGACAAGTGTCCCCTGTGGCAGAAATGGTCGGAGCTGCTGGTG
AATCAGTCAGAGGGTGCCAGTGCTTACATTCTGAATTACTTAATGTACATCCTATGGGCG
CTGCTGTTTGCATTTTTGGCTGTCTCCCTGGTGCGTGTATTTGCACCATATCGCTGTGGC
TCTGGCATACCAGAGATAAAGACCATTTTGAGCGGCTTTATCATCAGGGGCTACTTGGGG
AAGTGGACCCTGCTAATCAAGACAGTCACGCTGGTGCTGGTAGTGTCCTCCGGTCTGAGC
CTTGGGAAGGAAGGGCCGCTAGTGCACGTGGCTTGTTGCTGTGGCAACTTCTTCAGCAGC
CTTTTCTCCAAGTACAGCAAGAATGAGGGCAAGAGGCGGGAGGTGCTTTCAGCTGCAGCG
GCTGCTGGAGTCTCTGTTGCCTTTGGTGCACCAATTGGAGGCGTGCTTTTCAGTCTAGAA
GAGGTCAGTTACTACTTTCCCCTGAAGACCTTGTGGAGGTCATTTTTCGCAGCCCTGGTG
GCGGCCTTTACGCTGAGATCCATCAATCCCTTTGGGAATAGCCGTCTCGTTCTCTTTTAT
GTGGAATACCACACGCCCTGGTACATGGCTGAACTCTTCCCCTTCATCCTGCTTGGGGTC
TTCGGGGGCTTGTGGGGAACCCTCTTCATCCGCTGCAACATCGCCTGGTGCAGGAGGCGC
AAGACCACCAGGCTGGGGAAGTACCCGGTGCTGGAGGTCATTGTGGTGACTGCCATCACT
GCCATCATTGCCTACCCCAATCCCTACACACGCCAGAGCACCAGCGAGCTCATTTCTGAG
CTGTTCAATGACTGTGGAGCCCTTGAGTCTTCCCAGCTCTGTGACTACATCAATGACCCC
AACATGACTCGGCCTGTGGATGACATTCCAGACCGGCCGGCTGGTGTCGGTGTTTACACG
GCCATGTGGCAGCTGGCCCTGGCACTGATCTTCAAAATCGTCGTTACCATATTTACCTTT
GGCATGAAGATCCCGTCGGGCCTCTTCATCCCCAGCATGGCTGTGGGCGCGATAGCGGGC
AGGATGGTGGGAATTGGCGTGGAGCAGCTGGCCTACCATCACCATGACTGGTACTACTTC
AGGAACTGGTGCAGACCCGGTGCAGACTGTGTCACGCCAGGGCTGTACGCAATGGTGGGA
GCTGCGGCCTGCCTCGGTGGAGTTACCAGGATGACGGTGTCATTGGTGGTCATCATGTTT
GAATTAACCGGGGGTCTGGAGTACATCGTGCCCCTGATGGCGGCGGCTGTGACCAGCAAG
TGGGTAGCTGATGCATTTGGGAAAGAAGGCATCTACGAGGCCCACATCCACTTAAATGGG
TACCCTTTCCTTGACGTGAAGGACGAGTTTACTCACCGCACACTGGCCACCGACGTCATG
CGGCCCCGGCGGGGAGAGCCGCCACTGTCGGTGCTCACCCAGGACAGCATGACTGTCGAG
GACGTGGAGACGCTCATCAAGGAGACCGACTACAACGGCTTCCCCGTGGTGGTCTCCAGA
GACTCCGAGCGCCTCATTGGATTTGCCCAGAGGAGGGAACTGATTCTCGCAATAAATAAC
GCCAGACAGAGGCAGGAGGGCATTGTGAGCAATTCCATCATGTACTTCACGGAGGAACCC
CCCGAGCTGCCGGCCAACAGCCCACATCCCCTGAAGCTGCGGCGCATCCTGAACCTCAGC
CCGTTTACAGTGACAGACCACACTCCGATGGAAACGGTGGTGGATATCTTCCGGAAACTG
GGGCTTCGGCAGTGCCTGGTGACGCGGAGCGGGAGACTTCTTGGCATCATCACAAAAAAG
GATGTTCTGAGACATATGGCCCAGATGGCAAACCAGGACCCCGAATCCATCATGTTTAAT
TAG
Protein Properties
Number of Residues 760
Molecular Weight 84915.965
Theoretical pI 6.865
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>H(+)/Cl(-) exchange transporter 4
MVNAGAMSGSGNLMDFLDEPFPDVGTYEDFHTIDWLREKSRDTDRHRKITSKSKESIWEF
IKSLLDAWSGWVVMLLIGLLAGTLAGVIDLAVDWMTDLKEGVCLSAFWYSHEQCCWTSNE
TTFEDRDKCPLWQKWSELLVNQSEGASAYILNYLMYILWALLFAFLAVSLVRVFAPYACG
SGIPEIKTILSGFIIRGYLGKWTLLIKTVTLVLVVSSGLSLGKEGPLVHVACCCGNFFSS
LFSKYSKNEGKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALV
AAFTLRSINPFGNSRLVLFYVEYHTPWYMAELFPFILLGVFGGLWGTLFIRCNIAWCRRR
KTTRLGKYPVLEVIVVTAITAIIAYPNPYTRQSTSELISELFNDCGALESSQLCDYINDP
NMTRPVDDIPDRPAGVGVYTAMWQLALALIFKIVVTIFTFGMKIPSGLFIPSMAVGAIAG
RMVGIGVEQLAYHHHDWIIFRNWCRPGADCVTPGLYAMVGAAACLGGVTRMTVSLVVIMF
ELTGGLEYIVPLMAAAVTSKWVADAFGKEGIYEAHIHLNGYPFLDVKDEFTHRTLATDVM
RPRRGEPPLSVLTQDSMTVEDVETLIKETDYNGFPVVVSRDSERLIGFAQRRELILAIKN
ARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLSPFTVTDHTPMETVVDIFRKL
GLRQCLVTRSGRLLGIITKKDVLRHMAQMANQDPESIMFN
GenBank ID Protein 479159
UniProtKB/Swiss-Prot ID P51793
UniProtKB/Swiss-Prot Entry Name CLCN4_HUMAN
PDB IDs Not Available
GenBank Gene ID X77197
GeneCard ID CLCN4
GenAtlas ID CLCN4
HGNC ID HGNC:2022
References
General References
  1. van Slegtenhorst MA, Bassi MT, Borsani G, Wapenaar MC, Ferrero GB, de Conciliis L, Rugarli EI, Grillo A, Franco B, Zoghbi HY, Ballabio A: A gene from the Xp22.3 region shares homology with voltage-gated chloride channels. Hum Mol Genet. 1994 Apr;3(4):547-52. [PubMed:8069296 ]
  2. Kawasaki M, Fukuma T, Yamauchi K, Sakamoto H, Marumo F, Sasaki S: Identification of an acid-activated Cl(-) channel from human skeletal muscles. Am J Physiol. 1999 Nov;277(5 Pt 1):C948-54. [PubMed:10564087 ]
  3. Zdebik AA, Zifarelli G, Bergsdorf EY, Soliani P, Scheel O, Jentsch TJ, Pusch M: Determinants of anion-proton coupling in mammalian endosomal CLC proteins. J Biol Chem. 2008 Feb 15;283(7):4219-27. Epub 2007 Dec 6. [PubMed:18063579 ]