You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08208
Secondary Accession Numbers
  • 13919
Name Gamma-aminobutyric acid receptor subunit epsilon
Synonyms
  1. GABA(A) receptor subunit epsilon
Gene Name GABRE
Protein Type Unknown
Biological Properties
General Function Involved in ion transport
Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
postsynaptic membrane
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
gaba receptor activity
gaba-a receptor activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
Process
establishment of localization
transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs GABRE
Gene Sequence
>1521 bp
ATGTTGTCCAAAGTTCTTCCAGTCCTCCTAGGCATCTTATTGATCCTCCAGTCGAGGGTC
GAGGGACCTCAGACTGAATCAAAGAATGAAGCCTCTTCCCGTGATGTTGTCTATGGCCCC
CAGCCCCAGCCTCTGGAAAATCAGCTCCTCTCTGAGGAAACAAAGTCAACTGAGACTGAG
ACTGGGAGCAGAGTTGGCAAACTGCCAGAAGCCTCTCGCATCCTGAACACTATCCTGAGT
AATTATGACCACAAACTGCGCCCTGGCATTGGAGAGAAGCCCACTGTGGTCACTGTTGAG
ATCGCCGTCAACAGCCTTGGTCCTCTCTCTATCCTAGACATGGAATACACCATTGACATC
ATCTTCTCCCAGACCTGGTACGACGAACGCCTCTGTTACAACGACACCTTTGAGTCTCTT
GTTCTGAATGGCAATGTGGTGAGCCAGCTATGGATCCCGGACACCTTTTTTAGGAATTCT
AAGAGGACCCACGAGCATGAGATCACCATGCCCAACCAGATGGTCCGCATCTACAAGGAT
GGCAAGGTGTTGTACACAATTAGGATGACCATTGATGCCGGATGCTCACTCCACATGCTC
AGATTTCCAATGGATTCTCACTCTTGCCCTCTATCTTTCTCTAGCTTTTCCTATCCTGAG
AATGAGATGATCTACAAGTGGGAAAATTTCAAGCTTGAAATCAATGAGAAGAACTCCTGG
AAGCTCTTCCAGTTTGATTTTACAGGAGTGAGCAACAAAACTGAAATAATCACAACCCCA
GTTGGTGACTTCATGGTCATGACGATTTTCTTCAATGTGAGCAGGCGGTTTGGCTATGTT
GCCTTTCAAAACTATGTCCCTTCTTCCGTGACCACGATGCTCTCCTGGGTTTCCTTTTGG
ATCAAGACAGAGTCTGCTCCAGCCCGGACCTCTCTAGGGATCACCTCTGTTCTGACCATG
ACCACGTTGGGCACCTTTTCTCGTAAGAATTTCCCGCGTGTCTCCTATATCACAGCCTTG
GATTTCTATATCGCCATCTGCTTCGTCTTCTGCTTCTGCGCTCTGTTGGAGTTTGCTGTG
CTCAACTTCCTGATCTACAACCAGACAAAAGCCCATGCTTCTCCTAAACTCCGCCATCCT
CGTATCAATAGCCGTGCCCATGCCCGTACCCGTGCACGTTCCCGAGCCTGTGCCCGCCAA
CATCAGGAAGCTTTTGTGTGCCAGATTGTCACCACTGAGGGAAGTGATGGAGAGGAGCGC
CCGTCTTGCTCAGCCCAGCAGCCCCCTAGCCCAGGTAGCCCTGAGGGTCCCCGCAGCCTC
TGCTCCAAGCTGGCCTGCTGTGAGTGGTGCAAGCGTTTTAAGAAGTACTTCTGCATGGTC
CCCGATTGTGAGGGCAGTACCTGGCAGCAGGGCCGCCTCTGCATCCATGTCTACCGCCTG
GATAACTACTCGAGAGTTGTTTTCCCAGTGACTTTCTTCTTCTTCAATGTGCTCTACTGG
CTTGTTTGCCTTAACTTGTAG
Protein Properties
Number of Residues 506
Molecular Weight 57971.2
Theoretical pI 8.09
Pfam Domain Function
Signals
  • 1-22
Transmembrane Regions
  • 254-274
  • 281-301
  • 344-364
  • 486-506
Protein Sequence
>Gamma-aminobutyric acid receptor subunit epsilon
MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETE
TGSRVGKLPEASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDI
IFSQTWYDERLCYNDTFESLVLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKD
GKVLYTIRMTIDAGCSLHMLRFPMDSHSCPLSFSSFSYPENEMIYKWENFKLEINEKNSW
KLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYVPSSVTTMLSWVSFW
IKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVFCFCALLEFAV
LNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRL
DNYSRVVFPVTFFFFNVLYWLVCLNL
GenBank ID Protein 1857126
UniProtKB/Swiss-Prot ID P78334
UniProtKB/Swiss-Prot Entry Name GBRE_HUMAN
PDB IDs Not Available
GenBank Gene ID U66661
GeneCard ID GABRE
GenAtlas ID GABRE
HGNC ID HGNC:4085
References
General References
  1. Davies PA, Hanna MC, Hales TG, Kirkness EF: Insensitivity to anaesthetic agents conferred by a class of GABA(A) receptor subunit. Nature. 1997 Feb 27;385(6619):820-3. [PubMed:9039914 ]
  2. Wilke K, Gaul R, Klauck SM, Poustka A: A gene in human chromosome band Xq28 (GABRE) defines a putative new subunit class of the GABAA neurotransmitter receptor. Genomics. 1997 Oct 1;45(1):1-10. [PubMed:9339354 ]
  3. Garret M, Bascles L, Boue-Grabot E, Sartor P, Charron G, Bloch B, Margolskee RF: An mRNA encoding a putative GABA-gated chloride channel is expressed in the human cardiac conduction system. J Neurochem. 1997 Apr;68(4):1382-9. [PubMed:9084408 ]