Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08210
Secondary Accession Numbers
  • 13921
Name Gamma-aminobutyric acid receptor subunit gamma-3
Synonyms
  1. GABA(A) receptor subunit gamma-3
Gene Name GABRG3
Protein Type Unknown
Biological Properties
General Function Involved in ion transport
Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
postsynaptic membrane
Function
receptor activity
transmembrane receptor activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
molecular transducer activity
signal transducer activity
gaba receptor activity
gaba-a receptor activity
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
Process
establishment of localization
transport
gamma-aminobutyric acid signaling pathway
chloride transport
signaling
signaling pathway
cell surface receptor linked signaling pathway
anion transport
g-protein coupled receptor protein signaling pathway
inorganic anion transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 15q12
SNPs GABRG3
Gene Sequence
>1404 bp
ATGGCCCCGAAGCTGCTGCTCCTCCTCTGCCTGTTCTCGGGCTTGCACGCGCGGTCCAGA
AAGGTGGAAGAGGATGAATATGAAGATTCATCATCAAACCAAAAGTGGGTCTTGGCTCCA
AAATCCCAAGACACCGACGTGACTCTTATTCTCAACAAGTTGCTAAGAGAATATGATAAA
AAGCTGAGGCCAGATATTGGAATAAAACCGACCGTAATTGACGTTGACATTTATGTTAAC
AGCATTGGTCCTGTGTCATCAATAAACATGGAATACCAAATTGACATATTTTTTGCTCAG
ACCTGGACAGATAGTCGCCTTCGATTCAACAGCACAATGAAAATTCTTACTCTGAACAGC
AACATGGTGGGGTTAATCTGGATCCCAGACACCATCTTCCGCAATTCTAAAACCGCAGAG
GCTCACTGGATCACCACACCCAATCAGCTCCTCCGGATTTGGAATGACGGGAAAATCCTT
TACACTTTGAGGCTCACCATCAATGCTGAGTGCCAGCTGCAGCTGCACAACTTCCCCATG
GACGAACACTCCTGCCCGCTGATTTTCTCCAGCTATGGCTATCCCAAAGAAGAAATGATT
TATAGATGGAGAAAAAATTCAGTGGAGGCAGCTGACCAGAAATCATGGCGGCTTTATCAG
TTTGACTTCATGGGCCTCAGAAACACCACAGAAATCGTGACAACGTCTGCAGGTGATTAT
GTTGTCATGACTATATATTTTGAATTGAGTAGAAGAATGGGATACTTCACCATTCAGACA
TACATTCCCTGTATACTGACTGTGGTTTTATCCTGGGTGTCATTTTGGATCAAAAAAGAT
GCTACGCCAGCAAGAACAGCATTAGGCATCACCACGGTGCTGACCATGACCACCCTGAGC
ACCATCGCCAGGAAGTCCTTGCCACGCGTGTCCTACGTGACCGCCATGGACCTTTTTGTG
ACCGTGTGCTTCCTGTTTGTCTTCGCCGCGCTGATGGAGTATGCCACCCTCAACTACTAT
TCCAGCTGTAGAAAACCAACCACCACGAAGAAGACAACATCGTTACTACATCCAGATTCC
TCAAGATGGATTCCTGAGCGAATAAGCCTACAAGCCCCTTCCAACTATTCCCTCCTGGAC
ATGAGGCCACCACCAACTGCGATGATCACTTTAAACAATTCCGTTTACTGGCAGGAATTT
GAAGATACCTGTGTCTATGAGTGTCTGGATGGCAAAGACTGTCAGAGCTTCTTCTGCTGC
TATGAAGAATGTAAATCAGGATCCTGGAGGAAAGGGCGTATTCACATAGACATCTTGGAG
CTGGACTCGTACTCCCGGGTCTTTTTCCCCACGTCCTTCCTGCTCTTTAACCTGGTCTAC
TGGGTTGGATACCTGTATCTCTAA
Protein Properties
Number of Residues 467
Molecular Weight 54288.2
Theoretical pI 7.58
Pfam Domain Function
Signals
  • 1-17
Transmembrane Regions
  • 255-277
  • 281-303
  • 315-337
  • 444-467
Protein Sequence
>Gamma-aminobutyric acid receptor subunit gamma-3
MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLS
TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTKKTTSLLHPDS
SRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC
YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL
GenBank ID Protein 110347416
UniProtKB/Swiss-Prot ID Q99928
UniProtKB/Swiss-Prot Entry Name GBRG3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_033223.4
GeneCard ID GABRG3
GenAtlas ID GABRG3
HGNC ID HGNC:4088
References
General References
  1. Hadingham KL, Wafford KA, Thompson SA, Palmer KJ, Whiting PJ: Expression and pharmacology of human GABAA receptors containing gamma 3 subunits. Eur J Pharmacol. 1995 Nov 30;291(3):301-9. [PubMed:8719414 ]