Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08218
Secondary Accession Numbers
  • 13929
Name Glycine receptor subunit alpha-3
Synonyms Not Available
Gene Name GLRA3
Protein Type Unknown
Biological Properties
General Function Involved in ion transport
Specific Function The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing)
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
postsynaptic membrane
Function
binding
inhibitory extracellular ligand-gated ion channel activity
extracellular-glycine-gated chloride channel activity
transmitter-gated ion channel activity
glycine binding
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
carboxylic acid binding
amino acid binding
transporter activity
ion channel activity
ligand-gated ion channel activity
extracellular ligand-gated ion channel activity
Process
establishment of localization
transport
chloride transport
anion transport
inorganic anion transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
  3. Multi-pass membrane protein
  4. Cell junction
  5. synapse
  6. postsynaptic cell membrane
Gene Properties
Chromosome Location Chromosome:4
Locus 4q33-q34
SNPs GLRA3
Gene Sequence
>1395 bp
ATGGCCCACGTGAGACACTTTCGGACATTAGTTTCGGGATTTTACTTCTGGGAAGCAGCA
CTGTTACTCAGTTTGGTTGCCACAAAGGAAACAGACAGTGCAAGATCTCGAAGTGCTCCA
ATGTCACCTTCTGATTTTCTGGATAAATTAATGGGCAGGACATCAGGATATGATGCAAGA
ATCAGACCCAATTTTAAAGGCCCTCCAGTTAATGTCACATGCAACATATTCATCAACAGC
TTTGGCTCTATCGCAGAGACGACCATGGATTACAGAGTGAATATCTTTCTTCGTCAGAAA
TGGAATGATCCCCGCCTCGCGTACAGTGAATATCCTGACGACTCTTTAGACCTCGACCCC
TCCATGTTGGACTCCATTTGGAAACCTGATTTGTTCTTTGCCAATGAAAAGGGTGCCAAC
TTTCATGAAGTCACTACAGACAACAAATTGCTAAGAATTTTCAAAAATGGAAATGTTCTT
TATTCAATAAGATTAACATTAACACTTTCCTGTCCAATGGATCTCAAGAATTTTCCCATG
GATGTACAAACATGTATAATGCAACTGGAAAGCTTTGGGTACACAATGAATGATCTCATT
TTTGAATGGCAAGATGAGGCACCCGTACAAGTGGCAGAAGGACTCACTTTGCCCCAGTTT
CTGTTGAAAGAAGAAAAAGATTTACGATACTGCACTAAACATTACAATACAGGAAAGTTT
ACGTGTATAGAAGTGCGATTCCATCTGGAGCGACAAATGGGATACTATCTGATCCAGATG
TACATTCCCAGTCTCCTGATTGTTATTCTATCCTGGGTTTCATTCTGGATCAACATGGAT
GCAGCACCGGCCAGGGTAGCTCTGGGGATAACCACTGTGCTAACGATGACTACACAGAGT
TCAGGATCACGAGCTTCCTTGCCAAAAGTTTCATATGTCAAAGCTATTGATATTTGGATG
GCAGTATGCCTCCTTTTTGTGTTTTCAGCACTTCTGGAGTATGCAGCTGTAAATTTTGTA
TCAAGACAACACAAAGAACTTCTGAGATTTCGACGAAAGAGAAAGAATAAGACAGAAGCT
TTTGCACTGGAGAAGTTTTACCGTTTCTCAGATATGGATGATGAGGTAAGGGAAAGCCGA
TTCAGCTTCACAGCCTATGGAATGGGACCATGTCTACAAGCAAAGGATGGCATGACTCCA
AAGGGCCCCAACCACCCTGTCCAGGTAATGCCAAAAAGTCCTGATGAAATGAGGAAGGTC
TTTATCGACCGGGCCAAGAAGATTGATACCATCTCCCGAGCCTGCTTCCCATTAGCTTTT
TTGATTTTTAATATTTTCTACTGGGTTATCTATAAAATTCTTAGGCATGAGGATATTCAT
CAGCAGCAAGATTAA
Protein Properties
Number of Residues 464
Molecular Weight 53799.8
Theoretical pI 8.51
Pfam Domain Function
Signals
  • 1-33
Transmembrane Regions
  • 253-279
  • 286-303
  • 315-341
  • 434-451
Protein Sequence
>Glycine receptor subunit alpha-3
MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLTLSCPMDLKNFPM
DVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEEKDLRYCTKHYNTGKF
TCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEA
FALEKFYRFSDMDDEVRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKV
FIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHEDIHQQQD
GenBank ID Protein 110347441
UniProtKB/Swiss-Prot ID O75311
UniProtKB/Swiss-Prot Entry Name GLRA3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006529.2
GeneCard ID GLRA3
GenAtlas ID GLRA3
HGNC ID HGNC:4328
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Nikolic Z, Laube B, Weber RG, Lichter P, Kioschis P, Poustka A, Mulhardt C, Becker CM: The human glycine receptor subunit alpha3. Glra3 gene structure, chromosomal localization, and functional characterization of alternative transcripts. J Biol Chem. 1998 Jul 31;273(31):19708-14. [PubMed:9677400 ]