You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08220
Secondary Accession Numbers
  • 13932
Name Golgi-associated PDZ and coiled-coil motif-containing protein
Synonyms
  1. CFTR-associated ligand
  2. Fused in glioblastoma
  3. PDZ protein interacting specifically with TC10
  4. PIST
Gene Name GOPC
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Plays a role in intracellular protein trafficking and degradation. May regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. May also regulate the intracellular trafficking of the ADR1B receptor. May play a role in autophagy. Overexpression results in CFTR intracellular retention and degradation in the lysosomes
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
Cellular Location
  1. Cytoplasm
  2. Golgi apparatus membrane
  3. Peripheral membrane protein
  4. Peripheral membrane protein
  5. Golgi apparatus
  6. trans-Golgi network membrane
  7. Cell junction
  8. Cell junction
  9. synapse
  10. synapse
  11. Cell projection
  12. postsynaptic cell membrane
  13. postsynaptic density
  14. dendrite
Gene Properties
Chromosome Location Chromosome:6
Locus 6q21
SNPs GOPC
Gene Sequence
>1389 bp
ATGTCGGCGGGCGGTCCATGCCCAGCAGCAGCCGGAGGGGGCCCAGGGGGCGCCTCCTGC
TCCGTGGGGGCCCCTGGCGGGGTATCCATGTTCCGGTGGCTGGAGGTGCTGGAGAAGGAG
TTCGACAAAGCTTTTGTGGATGTGGATCTGCTCCTGGGAGAGATCGATCCAGACCAAGCG
GACATCACTTATGAGGGGCGACAGAAGATGACCAGCCTGAGCTCCTGCTTTGCACAGCTT
TGCCACAAAGCCCAGTCTGTGTCTCAAATCAACCACAAGCTGGAGGCACAGTTGGTGGAT
CTGAAATCTGAACTGACAGAAACCCAAGCAGAGAAAGTTGTTTTGGAGAAAGAAGTACAT
GATCAGCTTTTACAGCTGCACTCTATTCAGCTGCAGCTTCATGCTAAAACTGGTCAAAGT
GCTGACTCTGGTACCATTAAGGCAAAATTGTCTGGCCCCTCTGTGGAGGAGCTGGAAAGA
GAGCTTGAGGCAAACAAAAAAGAAAAAATGAAAGAAGCACAACTTGAAGCTGAAGTGAAA
TTGTTGAGAAAAGAGAATGAAGCCCTTCGTAGACATATAGCTGTTCTCCAGGCTGAAGTA
TATGGGGCGAGACTAGCTGCCAAGTACTTGGATAAGGAACTGGCAGGAAGGGTCCAACAG
ATACAATTGCTAGGACGAGATATGAAGGGACCTGCTCATGATAAGCTTTGGAACCAATTA
GAAGCTGAAATACATTTGCATCGTCACAAAACTGTGATCCGAGCCTGCAGAGGACGTAAT
GACTTGAAACGACCAATGCAAGCACCACCAGGCCATGATCAAGATTCCCTAAAGAAAAGC
CAAGGTGTTGGTCCAATTAGAAAAGTTCTCCTCCTTAAGGAAGATCATGAAGGCCTTGGC
ATTTCAATTACAGGTGGGAAAGAACATGGTGTTCCAATCCTCATCTCTGAGATCCATCCG
GGGCAACCTGCTGATAGATGCGGAGGGCTGCACGTTGGGGATGCTATTTTGGCAGTCAAC
GGAGTTAACCTAAGGGACACAAAGCATAAAGAAGCTGTAACTATTCTTTCTCAGCAGAGA
GGAGAGATTGAATTTGAAGTAGTTTATGTGGCTCCTGAAGTGGATTCTGATGATGAAAAC
GTAGAGTATGAAGATGAGAGTGGACATCGTTACCGTTTGTACCTTGATGAGTTAGAAGGA
GGTGGTAACCCTGGTGCTAGTTGCAAAGACACAAGTGGGGAAATCAAAGTATTACAAGGA
TTTAATAAGAAGGCAGTAACTGACACACATGAAAATGGAGACCTGGGCACTGCAAGTGAA
ACTCCGCTAGATGACGGTGCTTCAAAATTAGATGATCTGCACACTCTGTATCATAAAAAA
TCTTATTAA
Protein Properties
Number of Residues 462
Molecular Weight 50519.6
Theoretical pI 5.79
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Golgi-associated PDZ and coiled-coil motif-containing protein
MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQA
DITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVDLKSELTETQAEKVVLEKEVH
DQLLQLHSIQLQLHAKTGQSADSGTIKAKLSGPSVEELERELEANKKEKMKEAQLEAEVK
LLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQL
EAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLG
ISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQR
GEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNPGASCKDTSGEIKVLQG
FNKKAVTDTHENGDLGTASETPLDDGASKLDDLHTLYHKKSY
GenBank ID Protein 9966877
UniProtKB/Swiss-Prot ID Q9HD26
UniProtKB/Swiss-Prot Entry Name GOPC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020399.3
GeneCard ID GOPC
GenAtlas ID GOPC
HGNC ID HGNC:17643
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186 ]
  4. Charest A, Lane K, McMahon K, Park J, Preisinger E, Conroy H, Housman D: Fusion of FIG to the receptor tyrosine kinase ROS in a glioblastoma with an interstitial del(6)(q21q21). Genes Chromosomes Cancer. 2003 May;37(1):58-71. [PubMed:12661006 ]
  5. He J, Bellini M, Xu J, Castleberry AM, Hall RA: Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression. J Biol Chem. 2004 Nov 26;279(48):50190-6. Epub 2004 Sep 9. [PubMed:15358775 ]
  6. Neudauer CL, Joberty G, Macara IG: PIST: a novel PDZ/coiled-coil domain binding partner for the rho-family GTPase TC10. Biochem Biophys Res Commun. 2001 Jan 19;280(2):541-7. [PubMed:11162552 ]
  7. Cheng J, Wang H, Guggino WB: Regulation of cystic fibrosis transmembrane regulator trafficking and protein expression by a Rho family small GTPase TC10. J Biol Chem. 2005 Feb 4;280(5):3731-9. Epub 2004 Nov 15. [PubMed:15546864 ]
  8. Cheng J, Moyer BD, Milewski M, Loffing J, Ikeda M, Mickle JE, Cutting GR, Li M, Stanton BA, Guggino WB: A Golgi-associated PDZ domain protein modulates cystic fibrosis transmembrane regulator plasma membrane expression. J Biol Chem. 2002 Feb 1;277(5):3520-9. Epub 2001 Nov 13. [PubMed:11707463 ]
  9. Hruska-Hageman AM, Benson CJ, Leonard AS, Price MP, Welsh MJ: PSD-95 and Lin-7b interact with acid-sensing ion channel-3 and have opposite effects on H+- gated current. J Biol Chem. 2004 Nov 5;279(45):46962-8. Epub 2004 Aug 17. [PubMed:15317815 ]
  10. Charest A, Lane K, McMahon K, Housman DE: Association of a novel PDZ domain-containing peripheral Golgi protein with the Q-SNARE (Q-soluble N-ethylmaleimide-sensitive fusion protein (NSF) attachment protein receptor) protein syntaxin 6. J Biol Chem. 2001 Aug 3;276(31):29456-65. Epub 2001 May 30. [PubMed:11384996 ]
  11. Cheng J, Wang H, Guggino WB: Modulation of mature cystic fibrosis transmembrane regulator protein by the PDZ domain protein CAL. J Biol Chem. 2004 Jan 16;279(3):1892-8. Epub 2003 Oct 21. [PubMed:14570915 ]
  12. Hicks SW, Machamer CE: Isoform-specific interaction of golgin-160 with the Golgi-associated protein PIST. J Biol Chem. 2005 Aug 12;280(32):28944-51. Epub 2005 Jun 10. [PubMed:15951434 ]