Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08222
Secondary Accession Numbers
  • 13934
Name NADPH oxidase 3
Synonyms
  1. GP91-3
  2. MOX-2
  3. Mitogenic oxidase 2
  4. gp91phox homolog 3
Gene Name NOX3
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function NADPH oxidase which constitutively produces superoxide upon formation of a complex with CYBA/p22phox. Plays a role in the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity
Pathways
  • Thyroid hormone synthesis
  • Tyrosine Metabolism
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
electron carrier activity
iron ion binding
oxidoreductase activity
fad or fadh2 binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:6
Locus 6q25.3
SNPs NOX3
Gene Sequence
>1707 bp
ATGATGGGGTGCTGGATTTTGAATGAGGGTCTCTCCACCATATTAGTACTCTCATGGCTG
GGAATAAATTTTTATCTGTTTATTGACACGTTCTACTGGTATGAAGAGGAGGAGTCTTTC
CATTACACACGAGTTATTTTGGGTTCAACACTGGCTTGGGCACGAGCATCCGCACTGTGC
CTGAATTTTAACTGCATGCTAATTCTAATACCTGTCAGTCGAAACCTTATTTCATTCATA
AGAGGAACAAGTATTTGCTGCAGAGGACCGTGGAGGAGGCAATTAGACAAAAACCTCAGA
TTTCACAAACTGGTCGCCTATGGGATAGCTGTTAATGCAACCATCCACATCGTGGCGCAT
TTCTTCAACCTGGAACGCTACCACTGGAGCCAGTCCGAGGAGGCCCAGGGACTTCTGGCC
GCACTTTCCAAGCTGGGCAACACCCCTAACGAGAGCTACCTCAACCCTGTCCGGACCTTC
CCCACAAACACAACCACTGAATTGCTAAGGACAATAGCAGGCGTCACCGGTCTGGTGATC
TCTCTGGCTTTAGTCTTGATCATGACCTCGTCAACTGAGTTCATCAGACAGGCCTCCTAT
GAGTTGTTCTGGTACACACACCATGTTTTCATCGTCTTCTTTCTCAGCCTGGCCATCCAT
GGGACGGGTCGGATTGTTCGAGGCCAAACCCAAGACAGTCTCTCTCTGCACAACATCACC
TTCTGTAGAGACCGCTATGCAGAATGGCAGACAGTGGCCCAATGCCCCGTGCCTCAATTT
TCTGGCAAGGAACCCTCGGCTTGGAAATGGATTTTAGGCCCTGTGGTCTTGTATGCATGT
GAAAGAATAATTAGGTTCTGGCGATTTCAACAAGAAGTTGTCATTACCAAGGTGGTAAGC
CACCCCTCTGGAGTCCTGGAACTTCACATGAAAAAGCGTGGCTTTAAAATGGCGCCAGGG
CAGTACATCTTGGTGCAGTGCCCAGCCATATCTTCGCTGGAGTGGCACCCCTTCACCCTT
ACCTCTGCCCCCCAGGAAGACTTTTTCAGCGTGCACATCCGGGCAGCAGGAGACTGGACA
GCAGCGCTACTGGAGGCCTTTGGGGCAGAGGGACAGGCCCTCCAGGAGCCCTGGAGCCTG
CCAAGGCTGGCAGTGGACGGGCCCTTTGGAACTGCCCTGACAGATGTATTTCACTACCCA
GTGTGTGTGTGCGTTGCCGCGGGGATCGGAGTCACTCCCTTCGCTGCTCTTCTGAAATCT
ATATGGTACAAATGCAGTGAGGCACAGACCCCACTGAAGCTGAGCAAGGTGTATTTCTAC
TGGATTTGCCGGGATGCAAGAGCTTTTGAGTGGTTTGCTGATCTCTTACTCTCCCTGGAA
ACACGGATGAGTGAGCAGGGGAAAACTCACTTTCTGAGTTATCATATATTTCTTACCGGC
TGGGATGAAAATCAGGCTCTTCACATAGCTTTACACTGGGACGAAAATACTGACGTGATT
ACAGGCTTAAAGCAGAAGACCTTCTATGGGAGGCCCAACTGGAACAATGAGTTCAAGCAG
ATTGCCTACAATCACCCCAGCAGCAGTATTGGCGTGTTCTTCTGTGGACCTAAAGCTCTC
TCGAGGACACTTCAAAAGATGTGCCACTTGTATTCATCAGCTGACCCCAGAGGTGTTCAT
TTCTATTACAACAAGGAGAGCTTCTAG
Protein Properties
Number of Residues 568
Molecular Weight 64934.3
Theoretical pI 8.07
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 14-34
  • 52-72
  • 104-124
  • 168-188
  • 202-222
  • 396-416
Protein Sequence
>NADPH oxidase 3
MMGCWILNEGLSTILVLSWLGINFYLFIDTFYWYEEEESFHYTRVILGSTLAWARASALC
LNFNCMLILIPVSRNLISFIRGTSICCRGPWRRQLDKNLRFHKLVAYGIAVNATIHIVAH
FFNLERYHWSQSEEAQGLLAALSKLGNTPNESYLNPVRTFPTNTTTELLRTIAGVTGLVI
SLALVLIMTSSTEFIRQASYELFWYTHHVFIVFFLSLAIHGTGRIVRGQTQDSLSLHNIT
FCRDRYAEWQTVAQCPVPQFSGKEPSAWKWILGPVVLYACERIIRFWRFQQEVVITKVVS
HPSGVLELHMKKRGFKMAPGQYILVQCPAISSLEWHPFTLTSAPQEDFFSVHIRAAGDWT
AALLEAFGAEGQALQEPWSLPRLAVDGPFGTALTDVFHYPVCVCVAAGIGVTPFAALLKS
IWYKCSEAQTPLKLSKVYFYWICRDARAFEWFADLLLSLETRMSEQGKTHFLSYHIFLTG
WDENQALHIALHWDENTDVITGLKQKTFYGRPNWNNEFKQIAYNHPSSSIGVFFCGPKAL
SRTLQKMCHLYSSADPRGVHFYYNKESF
GenBank ID Protein 10441613
UniProtKB/Swiss-Prot ID Q9HBY0
UniProtKB/Swiss-Prot Entry Name NOX3_HUMAN
PDB IDs Not Available
GenBank Gene ID AF190122
GeneCard ID NOX3
GenAtlas ID NOX3
HGNC ID HGNC:7890
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Ueno N, Takeya R, Miyano K, Kikuchi H, Sumimoto H: The NADPH oxidase Nox3 constitutively produces superoxide in a p22phox-dependent manner: its regulation by oxidase organizers and activators. J Biol Chem. 2005 Jun 17;280(24):23328-39. Epub 2005 Apr 11. [PubMed:15824103 ]
  3. Cheng G, Cao Z, Xu X, van Meir EG, Lambeth JD: Homologs of gp91phox: cloning and tissue expression of Nox3, Nox4, and Nox5. Gene. 2001 May 16;269(1-2):131-40. [PubMed:11376945 ]
  4. Kikuchi H, Hikage M, Miyashita H, Fukumoto M: NADPH oxidase subunit, gp91(phox) homologue, preferentially expressed in human colon epithelial cells. Gene. 2000 Aug 22;254(1-2):237-43. [PubMed:10974555 ]
  5. Cheng G, Ritsick D, Lambeth JD: Nox3 regulation by NOXO1, p47phox, and p67phox. J Biol Chem. 2004 Aug 13;279(33):34250-5. Epub 2004 Jun 4. [PubMed:15181005 ]