Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08226
Secondary Accession Numbers
  • 13938
Name Sodium-dependent neutral amino acid transporter B(0)AT1
Synonyms
  1. Solute carrier family 6 member 19
  2. System B(0) neutral amino acid transporter AT1
Gene Name SLC6A19
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Transporter that mediates epithelial resorption of neutral amino acids across the apical membrane of epithelial cells in the kidney and intestine. It appears that leucine is the preferred substrate, but all large neutral non-aromatic L-amino acids bind to this transporter. Uptake of leucine is sodium-dependent. In contrast to other members of the neurotransmitter transporter family, does not appear to be chloride-dependent (By similarity).
Pathways
  • Mineral absorption
  • Protein digestion and absorption
Reactions Not Available
GO Classification
Biological Process
response to nutrient
amino acid transport
transmembrane transport
Cellular Component
plasma membrane
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
neutral amino acid transmembrane transporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location 5
Locus 5p15.33
SNPs SLC6A19
Gene Sequence
>1905 bp
ATGGTGAGGCTCGTGCTGCCCAACCCCGGCCTAGACGCCCGGATCCCGTCCCTGGCTGAG
CTGGAGACCATCGAGCAGGAGGAGGCCAGCTCCCGGCCGAAGTGGGACAACAAGGCGCAG
TACATGCTCACCTGCCTGGGCTTCTGCGTGGGCCTCGGCAACGTGTGGCGCTTCCCCTAC
CTGTGTCAGAGCCACGGAGGAGGAGCCTTCATGATCCCGTTCCTCATCCTGCTGGTCCTG
GAGGGCATCCCCCTGCTGTACCTGGAGTTCGCCATCGGGCAGCGGCTGCGGCGGGGCAGC
CTGGGTGTGTGGAGCTCCATCCACCCGGCCCTGAAGGGCCTAGGCCTGGCCTCCATGCTC
ACGTCCTTCATGGTGGGACTGTATTACAACACCATCATCTCCTGGATCATGTGGTACTTA
TTCAACTCCTTCCAGGAGCCTCTGCCCTGGAGCGACTGCCCGCTCAACGAGAACCAGACA
GGGTATGTGGACGAGTGCGCCAGGAGCTCCCCTGTGGACTACTTCTGGTACCGAGAGACG
CTCAACATCTCCACGTCCATCAGCGACTCGGGCTCCATCCAGTGGTGGATGCTGCTGTGC
CTGGCCTGCGCATGGAGCGTCCTGTACATGTGCACCATCCGCGGCATCGAGACCACCGGG
AAGGCCGTGTACATCACCTCCACGCTGCCCTATGTCGTCCTGACCATCTTCCTCATCCGA
GGCCTGACGCTGAAGGGCGCCACCAATGGCATCGTCTTCCTCTTCACGCCCAACGTCACG
GAGCTGGCCCAGCCGGACACCTGGCTGGACGCGGGCGCACAGGTCTTCTTCTCCTTCTCC
CTGGCCTTCGGGGGCCTCATCTCCTTCTCCAGCTACAACTCTGTGCACAACAACTGCGAG
AAGGACTCGGTGATTGTGTCCATCATCAACGGCTTCACATCGGTGTATGTGGCCATCGTG
GTCTACTCCGTCATTGGGTTCCGCGCCACGCAGCGCTACGACGACTGCTTCAGCACGAAC
ATCCTGACCCTCATCAACGGGTTCGACCTGCCTGAAGGCAACGTGACCCAGGAGAACTTT
GTGGACATGCAGCAGCGGTGCAACGCCTCCGACCCCGCGGCCTACGCGCAGCTGGTGTTC
CAGACCTGCGACATCAACGCCTTCCTCTCAGAGGCCGTGGAGGGCACAGGCCTGGCCTTC
ATCGTCTTCACCGAGGCCATCACCAAGATGCCGTTGTCCCCACTGTGGTCTGTGCTCTTC
TTCATTATGCTCTTCTGCCTGGGGCTGTCATCTATGTTTGGGAACATGGAGGGCGTCGTT
GTGCCCCTGCAGGACCTCAGAGTCATCCCCCCGAAGTGGCCCAAGGAGGTGCTCACAGGC
CTCATCTGCCTGGGGACATTCCTCATTGGCTTCATCTTCACGCTGAACTCCGGCCAGTAC
TGGCTCTCCCTGCTGGACAGCTATGCCGGCTCCATTCCCCTGCTCATCATCGCCTTCTGC
GAGATGTTCTCTGTGGTCTACGTGTACGGTGTGGACAGGTTCAATAAGGACATCGAGTTC
ATGATCGGCCACAAGCCCAACATCTTCTGGCAAGTCACGTGGCGCGTGGTCAGCCCCCTG
CTCATGCTGATCATCTTCCTCTTCTTCTTCGTGGTAGAGGTCAGTCAGGAGCTGACCTAC
AGCATCTGGGACCCTGGCTACGAGGAATTTCCCAAATCCCAGAAGATCTCCTACCCGAAC
TGGGTGTATGTGGTGGTGGTGATTGTGGCTGGAGTGCCCTCCCTCACCATCCCTGGCTAT
GCCATCTACAAGCTCATCAGGAACCACTGCCAGAAGCCAGGGGACCATCAGGGGCTGGTG
AGCACACTGTCCACAGCCTCCATGAACGGGGACCTGAAGTACTGA
Protein Properties
Number of Residues 634
Molecular Weight 71109.125
Theoretical pI 5.036
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent neutral amino acid transporter B(0)AT1
MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPY
LCQSHGGGAFMIPFLILLVLEGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGLGLASML
TSFMVGLYYNTIISWIMWYLFNSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRET
LNISTSISDSGSIQWWMLLCLACAWSVLYMCTIRGIETTGKAVYITSTLPYVVLTIFLIR
GLTLKGATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFSLAFGGLISFSSYNSVHNNCE
KDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQENF
VDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSPLWSVLF
FIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQY
WLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPL
LMLIIFLFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGY
AIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY
GenBank ID Protein 158255058
UniProtKB/Swiss-Prot ID Q695T7
UniProtKB/Swiss-Prot Entry Name S6A19_HUMAN
PDB IDs Not Available
GenBank Gene ID AK290811
GeneCard ID SLC6A19
GenAtlas ID SLC6A19
HGNC ID HGNC:27960
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Kleta R, Romeo E, Ristic Z, Ohura T, Stuart C, Arcos-Burgos M, Dave MH, Wagner CA, Camargo SR, Inoue S, Matsuura N, Helip-Wooley A, Bockenhauer D, Warth R, Bernardini I, Visser G, Eggermann T, Lee P, Chairoungdua A, Jutabha P, Babu E, Nilwarangkoon S, Anzai N, Kanai Y, Verrey F, Gahl WA, Koizumi A: Mutations in SLC6A19, encoding B0AT1, cause Hartnup disorder. Nat Genet. 2004 Sep;36(9):999-1002. Epub 2004 Aug 1. [PubMed:15286787 ]
  3. Seow HF, Broer S, Broer A, Bailey CG, Potter SJ, Cavanaugh JA, Rasko JE: Hartnup disorder is caused by mutations in the gene encoding the neutral amino acid transporter SLC6A19. Nat Genet. 2004 Sep;36(9):1003-7. Epub 2004 Aug 1. [PubMed:15286788 ]