Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08229
Secondary Accession Numbers
  • 13941
Name Protein tweety homolog 2
Synonyms
  1. hTTY2
Gene Name TTYH2
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function Probable large-conductance Ca(2+)-activated chloride channel. May play a role in Ca(2+) signal transduction. May be involved in cell proliferation and cell aggregation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.1
SNPs TTYH2
Gene Sequence
>1605 bp
ATGCAGGCGGCGCGCGTGGACTACATCGCTCCCTGGTGGGTCGTGTGGCTGCACAGCGTC
CCGCACGTCGGCCTGCGCCTGCAGCCCGTGAACAGCACCTTCAGCCCCGGCGACGAGAGT
TACCAGGAGTCGCTGCTGTTCCTGGGGCTGGTGGCCGCCGTCTGCCTGGGCCTGAACCTC
ATCTTCCTTGTGGCTTACCTGGTCTGTGCATGCCACTGCCGGCGGGACGATGCGGTGCAG
ACCAAGCAGCACCACTCCTGCTGCATCACCTGGACGGCCGTGGTGGCCGGGCTCATCTGC
TGTGCTGCGGTGGGCGTTGGTTTCTATGGAAACAGCGAGACCAACGATGGGGCGTACCAG
CTGATGTACTCCTTGGACGATGCCAACCACACCTTCTCTGGGATCGATGCTCTGGTTTCC
GGAACTACCCAGAAGATGAAGGTGGACCTAGAGCAGCACCTGGCCCGGCTCAGTGAGATC
TTTGCTGCCCGGGGCGATTACCTGCAGACCCTGAAGTTCATACAGCAGATGGCGGGCAGC
GTTGTTGTTCAGCTCTCAGGACTGCCCGTGTGGAGGGAGGTCACCATGGAGCTGACCAAG
CTATCCGACCAGACTGGCTACGTGGAGTACTACAGGTGGCTCTCCTACCTCCTGCTCTTT
ATCCTGGACCTGGTCATCTGCCTCATTGCCTGCCTGGGACTGGCCAAGCGCTCCAAGTGT
CTCCTGGCCTCGATGCTGTGCTGTGGGGCACTGAGCCTGCTCCTCAGTTGGGCATCCCTG
GCCGCTGATGGCTCTGCGGCAGTGGCCACCAGTGACTTCTGTGTGGCTCCTGACACCTTC
ATCCTGAACGTCACGGAGGGCCAGATCAGCACAGAGGTGACTCGCTACTACCTGTATTGC
AGCCAGAGTGGAAGCAGCCCCTTCCAGCAGACCCTGACCACCTTCCAGCGCGCACTTACC
ACCATGCAGATCCAGGTCGCGGGGCTGCTGCAGTTTGCCGTGCCCCTCTTCTCCACTGCA
GAGGAAGACCTGCTTGCAATCCAGCTCCTGCTGAACTCCTCAGAGTCCAGCCTTCACCAG
CTGACCGCCATGGTGGACTGCCGAGGGCTGCACAAGGATTATCTGGACGCTCTTGCTGGC
ATCTGCTACGACGGCCTCCAGGGCTTGCTGTACCTTGGCCTCTTCTCCTTCCTGGCCGCC
CTCGCCTTCTCCACCATGATCTGTGCAGGGCCAAGGGCCTGGAAGCACTTCACCACCAGA
AACAGAGACTACGATGACATTGATGATGATGACCCCTTTAACCCCCAAGCCTGGCGCATG
GCGGCTCACAGTCCCCCGAGGGGACAGCTTCACAGCTTCTGCAGCTACAGCAGTGGCCTG
GGAAGTCAGACCAGCCTGCAGCCCCCGGCCCAGACCATCTCCAACGCCCCTGTCTCCGAG
TACATGAACCAAGCCATGCTCTTTGGTAGGAACCCACGCTACGAGAACGTGCCACTAATC
GGGAGAGCCTCCCCTCCGCCTACGTACTCTCCCAGCATGAGAGCCACCTACCTGTCTGTG
GCGGATGAGCACCTGAGGCACTACGGGAATCAGTTTCCAGCCTAA
Protein Properties
Number of Residues 534
Molecular Weight 58771.7
Theoretical pI 5.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 45-65
  • 88-108
  • 214-234
  • 241-261
  • 389-409
Protein Sequence
>Protein tweety homolog 2
MQAARVDYIAPWWVVWLHSVPHVGLRLQPVNSTFSPGDESYQESLLFLGLVAAVCLGLNL
IFLVAYLVCACHCRRDDAVQTKQHHSCCITWTAVVAGLICCAAVGVGFYGNSETNDGAYQ
LMYSLDDANHTFSGIDALVSGTTQKMKVDLEQHLARLSEIFAARGDYLQTLKFIQQMAGS
VVVQLSGLPVWREVTMELTKLSDQTGYVEYYRWLSYLLLFILDLVICLIACLGLAKRSKC
LLASMLCCGALSLLLSWASLAADGSAAVATSDFCVAPDTFILNVTEGQISTEVTRYYLYC
SQSGSSPFQQTLTTFQRALTTMQIQVAGLLQFAVPLFSTAEEDLLAIQLLLNSSESSLHQ
LTAMVDCRGLHKDYLDALAGICYDGLQGLLYLGLFSFLAALAFSTMICAGPRAWKHFTTR
NRDYDDIDDDDPFNPQAWRMAAHSPPRGQLHSFCSYSSGLGSQTSLQPPAQTISNAPVSE
YMNQAMLFGRNPRYENVPLIGRASPPPTYSPSMRATYLSVADEHLRHYGNQFPA
GenBank ID Protein 53988385
UniProtKB/Swiss-Prot ID Q9BSA4
UniProtKB/Swiss-Prot Entry Name TTYH2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_032646.5
GeneCard ID TTYH2
GenAtlas ID TTYH2
HGNC ID HGNC:13877
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Suzuki M, Mizuno A: A novel human Cl(-) channel family related to Drosophila flightless locus. J Biol Chem. 2004 May 21;279(21):22461-8. Epub 2004 Mar 8. [PubMed:15010458 ]
  7. Rae FK, Hooper JD, Eyre HJ, Sutherland GR, Nicol DL, Clements JA: TTYH2, a human homologue of the Drosophila melanogaster gene tweety, is located on 17q24 and upregulated in renal cell carcinoma. Genomics. 2001 Oct;77(3):200-7. [PubMed:11597145 ]
  8. Toiyama Y, Mizoguchi A, Kimura K, Hiro J, Inoue Y, Tutumi T, Miki C, Kusunoki M: TTYH2, a human homologue of the Drosophila melanogaster gene tweety, is up-regulated in colon carcinoma and involved in cell proliferation and cell aggregation. World J Gastroenterol. 2007 May 21;13(19):2717-21. [PubMed:17569141 ]