You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08230
Secondary Accession Numbers
  • 13942
Name Protein tweety homolog 3
Synonyms
  1. hTTY3
Gene Name TTYH3
Protein Type Unknown
Biological Properties
General Function Involved in chloride channel activity
Specific Function Probable large-conductance Ca(2+)-activated chloride channel. May play a role in Ca(2+) signal transduction
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:7
Locus 7p22
SNPs TTYH3
Gene Sequence
>1572 bp
ATGGCCGGGGTCAGCTACGCGGCGCCCTGGTGGGTGAGCCTCCTGCACCGGCTGCCCCAC
TTCGACCTGAGCTGGGAGGCCACTAGCAGCCAGTTCCGGCCCGAGGACACCGACTACCAG
CAGGCCCTGCTGCTCCTGGGGGCCGCCGCCCTGGCCTGCCTCGCCCTGGACCTCCTCTTC
CTGCTCTTCTACTCCTTCTGGCTGTGCTGCCGGCGGCGCAAGAGCGAGGAGCACCTGGAC
GCCGACTGCTGCTGCACGGCCTGGTGTGTCATCATCGCCACGCTGGTGTGCAGCGCCGGC
ATCGCAGTGGGATTCTACGGCAACGGGGAGACCAGTGATGGCATCCATAGGGCCACCTAC
TCGCTCCGCCACGCCAACCGCACGGTGGCCGGGGTCCAGGACCGCGTGTGGGACACGGCG
GTGGGGCTGAACCACACGGCGGAGCCCAGCCTGCAGACCCTGGAGCGGCAGCTGGCCGGG
CGGCCCGAGCCCCTGCGAGCCGTACAGAGGCTGCAGGGCCTGCTGGAGACGCTGCTGGGC
TACACGGCCGCCATCCCCTTTTGGAGGAACACGGCGGTGTCGCTGGAGGTGCTGGCGGAG
CAGGTGGATCTCTACGACTGGTACAGGTGGCTGGGCTACCTGGGCCTGCTGCTGCTGGAC
GTCATCATCTGCCTCCTGGTGCTGGTTGGCCTCATCCGCAGCTCCAAGGGCATCCTGGTG
GGGGTCTGCCTGCTGGGAGTCCTGGCCCTGGTCATCAGCTGGGGCGCGCTGGGCTTGGAG
CTGGCTGTGTCCGTGGGCTCCAGCGACTTCTGTGTGGACCCTGACGCCTACGTGACCAAA
ATGGTGGAGGAGTACTCGGTGCTGAGTGGGGACATCCTGCAGTACTACCTGGCCTGCTCG
CCCCGCGCCGCCAACCCCTTCCAGCAGAAGCTGTCGGGCAGCCACAAGGCACTGGTGGAG
ATGCAGGATGTCGTGGCTGAGCTTCTGAGGACCGTCCCCTGGGAGCAGCCGGCCACTAAG
GACCCCCTCCTCCGCGTCCAGGAGGTGCTGAATGGCACGGAGGTGAACCTGCAGCACCTC
ACCGCCCTGGTGGACTGCCGCAGCCTGCATCTGGACTACGTGCAAGCGCTGACCGGCTTC
TGCTATGACGGCGTGGAGGGCCTCATCTACCTGGCCCTCTTCTCCTTCGTCACAGCCCTC
ATGTTCAGCTCCATCGTCTGCAGCGTCCCGCACACCTGGCAGCAAAAGAGAGGCCCTGAT
GAGGACGGGGAGGAGGAGGCCGCTCCAGGGCCGCGGCAGGCGCACGACAGCCTCTACCGC
GTCCACATGCCCAGCCTGTACAGCTGTGGCAGCAGCTACGGCAGTGAGACCAGCATCCCG
GCCGCGGCCCACACCGTCAGCAACGCCCCGGTCACTGAGTACATGAGCCAGAACGCTAAT
TTCCAGAACCCCCGCTGTGAGAACACCCCACTCATTGGGCGCGAGTCCCCGCCGCCCTCA
TACACCTCCAGCATGAGAGCCAAATACCTCGCCACGAGCCAGCCTCGCCCTGACTCCAGC
GGCAGCCACTAG
Protein Properties
Number of Residues 523
Molecular Weight 57544.1
Theoretical pI 5.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 43-63
  • 87-107
  • 212-232
  • 237-257
  • 387-407
Protein Sequence
>Protein tweety homolog 3
MAGVSYAAPWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQALLLLGAAALACLALDLLF
LLFYSFWLCCRRRKSEEHLDADCCCTAWCVIIATLVCSAGIAVGFYGNGETSDGIHRATY
SLRHANRTVAGVQDRVWDTAVGLNHTAEPSLQTLERQLAGRPEPLRAVQRLQGLLETLLG
YTAAIPFWRNTAVSLEVLAEQVDLYDWYRWLGYLGLLLLDVIICLLVLVGLIRSSKGILV
GVCLLGVLALVISWGALGLELAVSVGSSDFCVDPDAYVTKMVEEYSVLSGDILQYYLACS
PRAANPFQQKLSGSHKALVEMQDVVAELLRTVPWEQPATKDPLLRVQEVLNGTEVNLQHL
TALVDCRSLHLDYVQALTGFCYDGVEGLIYLALFSFVTALMFSSIVCSVPHTWQQKRGPD
EDGEEEAAPGPRQAHDSLYRVHMPSLYSCGSSYGSETSIPAAAHTVSNAPVTEYMSQNAN
FQNPRCENTPLIGRESPPPSYTSSMRAKYLATSQPRPDSSGSH
GenBank ID Protein 51100978
UniProtKB/Swiss-Prot ID Q9C0H2
UniProtKB/Swiss-Prot Entry Name TTYH3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_025250.2
GeneCard ID TTYH3
GenAtlas ID TTYH3
HGNC ID HGNC:22222
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [PubMed:12690205 ]
  8. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  9. Jikuya H, Takano J, Kikuno R, Hirosawa M, Nagase T, Nomura N, Ohara O: Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones. DNA Res. 2003 Feb 28;10(1):49-57. [PubMed:12693554 ]
  10. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  11. Suzuki M, Mizuno A: A novel human Cl(-) channel family related to Drosophila flightless locus. J Biol Chem. 2004 May 21;279(21):22461-8. Epub 2004 Mar 8. [PubMed:15010458 ]