You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08235
Secondary Accession Numbers
  • 13947
Name Carboxypeptidase M
Synonyms
  1. CPM
Gene Name CPM
Protein Type Unknown
Biological Properties
General Function Involved in carboxypeptidase activity
Specific Function Specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins
Pathways Not Available
Reactions Not Available
GO Classification
Function
exopeptidase activity
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
metallocarboxypeptidase activity
carboxypeptidase activity
peptidase activity
peptidase activity, acting on l-amino acid peptides
Process
metabolic process
macromolecule metabolic process
protein metabolic process
proteolysis
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location Chromosome:1
Locus 12q14.3
SNPs CPM
Gene Sequence
>1332 bp
ATGGACTTCCCGTGCCTCTGGCTAGGGCTGTTGCTGCCTTTGGTAGCTGCGCTGGATTTC
AACTACCACCGCCAGGAAGGGATGGAAGCGTTTTTGAAGACTGTTGCCCAAAACTACAGT
TCTGTCACTCACTTACACAGTATTGGGAAATCTGTGAAAGGTAGAAACCTGTGGGTTCTT
GTTGTGGGGCGGTTTCCAAAGGAACACAGAATTGGGATTCCAGAGTTCAAATACGTGGCA
AATATGCATGGAGATGAGACTGTTGGGCGGGAGCTGCTGCTCCATCTGATTGACTATCTC
GTAACCAGTGATGGCAAAGACCCTGAAATCACAAATCTGATCAATAGTACCCGGATACAC
ATCATGCCTTCCATGAACCCAGATGGATTTGAAGCCGTCAAAAAGCCTGACTGTTATTAC
AGCATCGGAAGGGAAAATTATAACCAGTATGACTTGAATCGAAATTTCCCCGATGCTTTT
GAATATAATAATGTCTCAAGGCAGCCTGAAACTGTGGCAGTCATGAAGTGGCTGAAAACA
GAGACGTTTGTCCTCTCTGCAAACCTCCATGGTGGTGCCCTCGTGGCCAGTTACCCATTT
GATAATGGTGTTCAAGCAACTGGGGCATTATACTCCCGAAGCTTAACGCCTGATGATGAT
GTTTTTCAATATCTTGCACATACCTATGCTTCAAGAAATCCCAACATGAAGAAAGGAGAC
GAGTGTAAAAACAAAATGAACTTTCCTAATGGTGTTACAAATGGATACTCTTGGTATCCA
CTCCAAGGTGGAATGCAAGATTACAACTACATCTGGGCCCAGTGTTTTGAAATTACGTTG
GAGCTGTCATGCTGTAAATATCCTCGTGAGGAGAAGCTTCCATCCTTTTGGAATAATAAC
AAAGCCTCATTAATTGAATATATAAAGCAGGTGCACCTAGGTGTAAAGGGTCAAGTTTTT
GATCAGAATGGAAATCCATTACCCAATGTAATTGTGGAAGTCCAAGACAGAAAACATATC
TGCCCCTATAGAACCAACAAATATGGAGAGTATTATCTCCTTCTCTTGCCTGGGTCCTAT
ATAATAAATGTTACAGTCCCTGGACATGATCCACACATCACAAAGGTGATTATTCCGGAG
AAATCCCAGAACTTCAGTGCTCTTAAAAAGGATATTCTACTTCCATTCCAAGGGCAATTG
GATTCTATCCCAGTATCAAATCCTTCATGCCCAATGATTCCTCTATACAGAAATTTGCCA
GACCACTCAGCTGCAACAAAGCCTAGTTTGTTCTTATTTTTAGTGAGTCTTTTGCACATA
TTCTTCAAATAA
Protein Properties
Number of Residues 443
Molecular Weight 50513.5
Theoretical pI 7.4
Pfam Domain Function
Signals
  • 1-17
Transmembrane Regions
  • None
Protein Sequence
>Carboxypeptidase M
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP
DHSAATKPSLFLFLVSLLHIFFK
GenBank ID Protein 12043756
UniProtKB/Swiss-Prot ID P14384
UniProtKB/Swiss-Prot Entry Name CBPM_HUMAN
PDB IDs
GenBank Gene ID AF262947
GeneCard ID CPM
GenAtlas ID CPM
HGNC ID HGNC:2311
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  4. Elortza F, Nuhse TS, Foster LJ, Stensballe A, Peck SC, Jensen ON: Proteomic analysis of glycosylphosphatidylinositol-anchored membrane proteins. Mol Cell Proteomics. 2003 Dec;2(12):1261-70. Epub 2003 Sep 29. [PubMed:14517339 ]
  5. Elortza F, Mohammed S, Bunkenborg J, Foster LJ, Nuhse TS, Brodbeck U, Peck SC, Jensen ON: Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment. J Proteome Res. 2006 Apr;5(4):935-43. [PubMed:16602701 ]
  6. Tan F, Chan SJ, Steiner DF, Schilling JW, Skidgel RA: Molecular cloning and sequencing of the cDNA for human membrane-bound carboxypeptidase M. Comparison with carboxypeptidases A, B, H, and N. J Biol Chem. 1989 Aug 5;264(22):13165-70. [PubMed:2753907 ]
  7. Bektas A, Hughes JN, Warram JH, Krolewski AS, Doria A: Type 2 diabetes locus on 12q15. Further mapping and mutation screening of two candidate genes. Diabetes. 2001 Jan;50(1):204-8. [PubMed:11147789 ]
  8. Pessoa LG, da Silva ID, Baptista HA, Pesquero JL, Paiva AC, Bader M, Pesquero JB: Molecular structure and alternative splicing of the human carboxypeptidase M gene. Biol Chem. 2002 Feb;383(2):263-9. [PubMed:11934264 ]
  9. Tan F, Balsitis S, Black JK, Blochl A, Mao JF, Becker RP, Schacht D, Skidgel RA: Effect of mutation of two critical glutamic acid residues on the activity and stability of human carboxypeptidase M and characterization of its signal for glycosylphosphatidylinositol anchoring. Biochem J. 2003 Mar 1;370(Pt 2):567-78. [PubMed:12457462 ]
  10. Reverter D, Maskos K, Tan F, Skidgel RA, Bode W: Crystal structure of human carboxypeptidase M, a membrane-bound enzyme that regulates peptide hormone activity. J Mol Biol. 2004 Apr 23;338(2):257-69. [PubMed:15066430 ]