Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08236
Secondary Accession Numbers
  • 13948
Name U8 snoRNA-decapping enzyme
Synonyms
  1. Nucleoside diphosphate-linked moiety X motif 16
  2. Nudix motif 16
  3. U8 snoRNA-binding protein H29K
  4. m7GpppN-mRNA hydrolase
Gene Name NUDT16
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function RNA-decapping enzyme that binds specifically to U8 snoRNA. Part of the U8 snoRNP complex that is required for the accumulation of mature 5.8S and 28S rRNA. Has diphosphatase activity and removes m7G and m227G caps from U8 snoRNA. Has broad substrate specificity with manganese or cobalt as cofactor and can act on various RNA species (in vitro).
Pathways
  • RNA degradation
Reactions
M(7)G5'ppp5'-mRNA + Water → m(7)GDP + 5'-phospho-mRNA details
GO Classification
Biological Process
adenosine to inosine editing
dITP catabolic process
IDP catabolic process
negative regulation of rRNA processing
positive regulation of cell cycle process
positive regulation of double-strand break repair
snoRNA catabolic process
XDP catabolic process
positive regulation of cell proliferation
mRNA catabolic process
Cellular Component
cytoplasm
nucleolus
nucleoplasm
Function
catalytic activity
hydrolase activity
Molecular Function
nucleotide phosphatase activity
m7G(5')pppN diphosphatase activity
cobalt ion binding
ITP binding
XTP binding
manganese ion binding
magnesium ion binding
snoRNA binding
metalloexopeptidase activity
protein homodimerization activity
GTP binding
dITP diphosphatase activity
mRNA binding
Cellular Location
  1. Nucleus
  2. Nucleus
  3. nucleolus
  4. nucleoplasm
Gene Properties
Chromosome Location 3
Locus 3q22.1
SNPs NUDT16
Gene Sequence
>588 bp
ATGGCCGGAGCCCGCAGGCTGGAGCTAGGCGAGGCCCTGGCGCTGGGGTCGGGCTGGCGT
CATGCGTGCCACGCTCTCCTCTACGCGCCGGACCCTGGGATGCTCTTCGGCCGCATCCCG
CTGCGCTACGCCATACTGATGCAGATGCGCTTCGATGGACGCCTGGGCTTCCCCGGCGGA
TTCGTGGACACGCAGGACAGAAGCCTAGAGGACGGGCTGAACCGCGAGCTGCGCGAGGAG
CTGGGCGAAGCGGCTGCCGCTTTCCGCGTGGAGCGCACTGACTACCGCAGCTCCCACGTC
GGGTCAGGGCCACGCGTTGTGGCCCACTTCTATGCCAAGCGTCTGACGCTCGAGGAGCTG
TTGGCTGTGGAGGCCGGCGCAACACGCGCCAAGGACCACGGGCTGGAGGTGCTGGGCCTG
GTGCGAGTGCCCCTGTATACCCTGCGGGATGGTGTAGGAGGCCTGCCTACCTTCCTGGAG
AATTCCTTTATTGGCTCTGCGCGGGAGCAGTTACTTGAAGCTCTCCAGGACTTGGGACTG
CTGCAGTCTGGCTCTATTTCAGGCCTTAAGATTCCAGCTCATCACTAG
Protein Properties
Number of Residues 195
Molecular Weight 21273.13
Theoretical pI 6.89
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>U8 snoRNA-decapping enzyme
MAGARRLELGEALALGSGWRHACHALLYAPDPGMLFGRIPLRYAILMQMRFDGRLGFPGG
FVDTQDRSLEDGLNRELREELGEAAAAFRVERTDYRSSHVGSGPRVVAHFYAKRLTLEEL
LAVEAGATRAKDHGLEVLGLVRVPLYTLRDGVGGLPTFLENSFIGSAREQLLEALQDLGL
LQSGSISGLKIPAHH
GenBank ID Protein 285026434
UniProtKB/Swiss-Prot ID Q96DE0
UniProtKB/Swiss-Prot Entry Name NUD16_HUMAN
PDB IDs
GenBank Gene ID NM_152395.2
GeneCard ID NUDT16
GenAtlas ID NUDT16
HGNC ID HGNC:26442
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  4. Ghosh T, Peterson B, Tomasevic N, Peculis BA: Xenopus U8 snoRNA binding protein is a conserved nuclear decapping enzyme. Mol Cell. 2004 Mar 26;13(6):817-28. [PubMed:15053875 ]
  5. Peculis BA, Reynolds K, Cleland M: Metal determines efficiency and substrate specificity of the nuclear NUDIX decapping proteins X29 and H29K (Nudt16). J Biol Chem. 2007 Aug 24;282(34):24792-805. Epub 2007 Jun 13. [PubMed:17567574 ]