Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08239
Secondary Accession Numbers
  • 13951
Name COMM domain-containing protein 1
Synonyms
  1. Protein Murr1
Gene Name COMMD1
Protein Type Unknown
Biological Properties
General Function Involved in identical protein binding
Specific Function Inhibits TNF-induced NFKB1 activation. May function to facilitate biliary copper excretion within hepatocytes
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:2
Locus 2p15
SNPs COMMD1
Gene Sequence
>573 bp
ATGGCGGCGGGCGAGCTTGAGGGTGGCAAACCCCTGAGCGGGCTGCTGAATGCGCTGGCC
CAGGACACTTTCCACGGGTACCCCGGCATCACAGAGGAGCTGCTACGGAGCCAGCTATAT
CCAGAGGTGCCACCCGAGGAGTTCCGCCCCTTTCTGGCAAAGATGAGGGGGATTCTTAAG
TCTATTGCGTCTGCAGACATGGATTTCAACCAGCTGGAGGCATTCTTGACTGCTCAAACC
AAAAAGCAAGGTGGGATCACATCTGACCAAGCTGCTGTCATTTCCAAATTCTGGAAGAGC
CACAAGACAAAAATCCGTGAGAGCCTCATGAACCAGAGCCGCTGGAATAGCGGGCTTCGG
GGCCTGAGCTGGAGAGTTGATGGCAAGTCTCAGTCAAGGCACTCAGCTCAAATACACACA
CCTGTTGCCATTATAGAGCTGGAATTAGGCAAATATGGACAGGAATCTGAATTTCTGTGT
TTGGAATTTGATGAGGTCAAAGTCAACCAAATTCTGAAGACGCTGTCAGAGGTAGAAGAA
AGTATCAGCACACTGATCAGCCAGCCTAACTGA
Protein Properties
Number of Residues 190
Molecular Weight 21177.9
Theoretical pI 6.13
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>COMM domain-containing protein 1
MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILK
SIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLR
GLSWRVDGKSQSRHSAQIHTPVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEE
SISTLISQPN
GenBank ID Protein 47169773
UniProtKB/Swiss-Prot ID Q8N668
UniProtKB/Swiss-Prot Entry Name COMD1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB178811
GeneCard ID COMMD1
GenAtlas ID COMMD1
HGNC ID HGNC:23024
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Tao TY, Liu F, Klomp L, Wijmenga C, Gitlin JD: The copper toxicosis gene product Murr1 directly interacts with the Wilson disease protein. J Biol Chem. 2003 Oct 24;278(43):41593-6. Epub 2003 Sep 10. [PubMed:12968035 ]
  4. Muller T, van de Sluis B, Zhernakova A, van Binsbergen E, Janecke AR, Bavdekar A, Pandit A, Weirich-Schwaiger H, Witt H, Ellemunter H, Deutsch J, Denk H, Muller W, Sternlieb I, Tanner MS, Wijmenga C: The canine copper toxicosis gene MURR1 does not cause non-Wilsonian hepatic copper toxicosis. J Hepatol. 2003 Feb;38(2):164-8. [PubMed:12547404 ]
  5. Stuehler B, Reichert J, Stremmel W, Schaefer M: Analysis of the human homologue of the canine copper toxicosis gene MURR1 in Wilson disease patients. J Mol Med (Berl). 2004 Sep;82(9):629-34. Epub 2004 Jun 17. [PubMed:15205742 ]
  6. van De Sluis B, Rothuizen J, Pearson PL, van Oost BA, Wijmenga C: Identification of a new copper metabolism gene by positional cloning in a purebred dog population. Hum Mol Genet. 2002 Jan 15;11(2):165-73. [PubMed:11809725 ]
  7. Burstein E, Hoberg JE, Wilkinson AS, Rumble JM, Csomos RA, Komarck CM, Maine GN, Wilkinson JC, Mayo MW, Duckett CS: COMMD proteins, a novel family of structural and functional homologs of MURR1. J Biol Chem. 2005 Jun 10;280(23):22222-32. Epub 2005 Mar 30. [PubMed:15799966 ]
  8. de Bie P, van de Sluis B, Burstein E, Duran KJ, Berger R, Duckett CS, Wijmenga C, Klomp LW: Characterization of COMMD protein-protein interactions in NF-kappaB signalling. Biochem J. 2006 Aug 15;398(1):63-71. [PubMed:16573520 ]