Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08242
Secondary Accession Numbers
  • 13954
Name Cytochrome c oxidase assembly protein COX11, mitochondrial
Synonyms Not Available
Gene Name COX11
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
copper ion binding
Cellular Location
  1. Single-pass membrane protein
  2. Mitochondrion inner membrane
  3. Intermembrane side
Gene Properties
Chromosome Location Chromosome:1
Locus 17q22
SNPs COX11
Gene Sequence
>831 bp
ATGGGAGGGCTCTGGCGTCCTGGATGGAGGTGCGTTCCTTTCTGTGGCTGGCGCTGGATC
CACCCTGGGTCTCCAACCAGGGCTGCAGAGAGGGTAGAGCCGTTTCTTAGGCCAGAGTGG
AGTGGGACAGGGGGTGCCGAGAGAGGACTGAGGTGGCTTGGGACATGGAAGCGCTGCAGC
CTTCGAGCCCGGCATCCAGCATTGCAGCCGCCGCGGCGGCCTAAGAGCTCGAACCCTTTC
ACACGCGCGCAGGAGGAGGAGCGGCGGCGGCAGAACAAGACGACCCTCACTTACGTGGCC
GCTGTCGCCGTGGGCATGCTGGGGGCGTCCTACGCTGCCGTACCCCTTTATCGGCTCTAT
TGCCAGACTACTGGACTTGGAGGATCAGCAGTTGCAGGTCATGCCTCAGACAAGATTGAA
AACATGGTGCCTGTTAAAGATCGAATCATTAAAATTAGCTTTAATGCAGATGTGCATGCA
AGTCTCCAGTGGAACTTTAGACCTCAGCAAACAGAAATATATGTGGTGCCAGGAGAGACT
GCACTGGCGTTTTACAGAGCTAAGAATCCTACTGACAAACCAGTAATTGGAATTTCTACA
TACAATATTGTTCCATTTGAAGCTGGACAGTATTTCAATAAAATACAGTGCTTCTGTTTT
GAAGAACAAAGGCTTAATCCCCAAGAGGAAGTAGATATGCCAGTGTTTTTCTACATTGAT
CCTGAATTTGCTGAAGATCCAAGAATGATTAAAGTTGATCTTATCACTCTTTCTTACACT
TTTTTTGAAGCAAAGGAAGGGCACAAGTTGCCAGTTCCAGGATATAATTGA
Protein Properties
Number of Residues 276
Molecular Weight 31429.7
Theoretical pI 9.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 96-114
Protein Sequence
>Cytochrome c oxidase assembly protein COX11, mitochondrial
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCS
LRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLY
CQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGET
ALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYID
PEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
GenBank ID Protein 3170264
UniProtKB/Swiss-Prot ID Q9Y6N1
UniProtKB/Swiss-Prot Entry Name COX11_HUMAN
PDB IDs Not Available
GenBank Gene ID AF044321
GeneCard ID COX11
GenAtlas ID COX11
HGNC ID HGNC:2261
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yu W, Andersson B, Worley KC, Muzny DM, Ding Y, Liu W, Ricafrente JY, Wentland MA, Lennon G, Gibbs RA: Large-scale concatenation cDNA sequencing. Genome Res. 1997 Apr;7(4):353-8. [PubMed:9110174 ]
  3. Petruzzella V, Tiranti V, Fernandez P, Ianna P, Carrozzo R, Zeviani M: Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain. Genomics. 1998 Dec 15;54(3):494-504. [PubMed:9878253 ]
  4. Guo D, Ling J, Wang MH, She JX, Gu J, Wang CY: Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis. Mol Pain. 2005 Apr 19;1:15. [PubMed:15840172 ]