You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08245
Secondary Accession Numbers
  • 13957
Name Copper homeostasis protein cutC homolog
Synonyms Not Available
Gene Name CUTC
Protein Type Unknown
Biological Properties
General Function Involved in copper ion binding
Specific Function Involved in copper homeostasis
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
transition metal ion binding
copper ion binding
Process
cation homeostasis
biological regulation
di-, tri-valent inorganic cation homeostasis
copper ion homeostasis
regulation of biological quality
homeostatic process
chemical homeostasis
ion homeostasis
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 10q24.2
SNPs CUTC
Gene Sequence
>822 bp
ATGAAAAGGCAGGGGGCCTCCTCTGAGCGAAAACGAGCGCGGATACCGTCCGGGAAGGCC
GGAGCAGCAAATGGATTTCTCATGGAAGTTTGTGTTGATTCAGTGGAATCAGCTGTGAAT
GCAGAAAGAGGAGGTGCTGATCGGATTGAATTATGTTCTGGTTTATCAGAGGGGGGAACT
ACACCCAGCATGGGTGTCCTTCAAGTAGTGAAGCAGAGTGTTCAGATCCCAGTTTTTGTG
ATGATTCGGCCACGGGGAGGTGATTTTTTGTATTCAGATCGTGAAATTGAGGTGATGAAG
GCTGACATTCGTCTTGCCAAGCCTTATGGTGCTGATGGTTTGGTTTTTGGGGCATTGACT
GAAGATGGACACATTGACAAAGAGCTGTGTATGTCCCTTATGGCTATTTGCCGCCCTCTG
CCAGTCACTTTCCACCGAGCCTTTGACATGGTTCATGATCCAATGGCAGCTCTGGAGACC
CTCTTAACCTTGGGATTTGAACGCGTGTTGACCAGTGGATGTGACAGTTCAGCATTAGAA
GGGCTACCCCTAATAAATCGACTCATTGAGCAGGCAAAAGGCAGGATTGTGGTAATGCCA
GGAGGTGGTATAACAGACAGAAATCTACAAAGGATCCTTGAGGGTTCAGGTGCTACAGAA
TTCCACTGTTCTGCTCGGTCTACTAGAGACTCGGGAATGAAGTTTCGAAATTCATCTGTT
GCCATGGGAGCCTCACTTTCTTGCTCAGAATATTCCCTAAAGGTAACAGATGTGACCAAA
GTAAGGACTTTGAATGCTATCGCAAAGAACATCCTGGTGTAG
Protein Properties
Number of Residues 273
Molecular Weight 29340.7
Theoretical pI 8.29
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Copper homeostasis protein cutC homolog
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGT
TPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSGMKFRNSSV
AMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
GenBank ID Protein 4680703
UniProtKB/Swiss-Prot ID Q9NTM9
UniProtKB/Swiss-Prot Entry Name CUTC_HUMAN
PDB IDs Not Available
GenBank Gene ID AF132966
GeneCard ID CUTC
GenAtlas ID CUTC
HGNC ID HGNC:24271
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Lai CH, Chou CY, Ch'ang LY, Liu CS, Lin W: Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics. Genome Res. 2000 May;10(5):703-13. [PubMed:10810093 ]